Conserved Protein Domain Family
PLN02403

?
PLN02403: PLN02403 
aminocyclopropanecarboxylate oxidase
Statistics
?
PSSM-Id: 178025
View PSSM: PLN02403
Aligned: 6 rows
Threshold Bit Score: 579.504
Threshold Setting Gi: 242096230
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225444956   1 MEVPMIDFDKLDGEKRAETKALLHQACEKWGFFQIDNHGVDKKLMEKVKHLVNTHYEEIMKRSFYESEIAKALeDKETAS 80 
15224803    9 MEIPVIDFAELDGEKRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSHYEEHLKEKFYQSEMVKAL-SEGKTS 87 
224091345   1 MEIPVIDLSQLEGENRSKTMALLHQACEKWGFFQVENHGLEKKLMDKVKQLVNAHYEENLKESFYESEIAKGLmNKG--- 77 
255546169   1 MEIPVIDFSQLKGENRSKMLAVLQEACEKWGFFQVENHGIDKKLMEKVKQLVNSHYEQNLKETFYKSEIAKRLdNKGNTS 80 
242096230   1 MEIPVIKMDQLHGEKRSETLSLLHNACAQWGFFWLENHGVNEDLMNKMKDLVNKHYEQDMEKNFYSSEKAKILdYEKASS 80 
297832200   9 MEIPVIDFGELDGENRSKTMSLLDHACDKWGFFMVDNHGIDKELMEKVKKMINSYYEEHLKEKFYQSEMVKAL-SEGKTS 87 
225444956  81 NIDWESSFFLWHRPTSNIDEFTNISEDLRKTMDEYIAQLFKLAEKLSELMCENLGLEKGYIREAFSGNAGPSVGTKVAKY 160
15224803   88 DADWESSFFISHKPTSNICQIPNISEELSKTMDEYVCQLHKFAERLSKLMCENLGLDQEDIMNAFSGPKGPAFGTKVAKY 167
224091345  78 DVDWESSFFIWHRPTSNINEIHNLSENLRQIMDEYIAQLIQLAEKLSQLMSENLGLDKDYIKESFSGAKGPSVGTKVAKY 157
255546169  81 DIDWESSYFIWHRPTSNINDIPNLQEDFGKSMDEYITQLIELAEKISELMCENLGLEKDDIKEAFSGDGGPSVGTKVAKY 160
242096230  81 NVDWECSFMYRHQPKSNSHDIPEL---LRATVFEYAEEVIKLAEQLAAVMSENLGLDKDYIEQAFS---KPSVGIKVAKY 154
297832200  88 DADWESSFFISHKPTSNFCEILNISVERSKTMDEYVCQLHKFAERLSKLMSENLGLDQEYIMNAFSGSKGPAFGTKVAKY 167
225444956 161 PQCPRPELVRGLREHTDAGGIILLLQDDQVPGLEFYKDGEWVVIPPSKNNTIFVNTGDQIEVLSNGRYKSTLHRVMADKN 240
15224803  168 PECPRPELMRGLREHTDAGGIILLLQDDQVPGLEFFKDGKWVPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVMTVKH 247
224091345 158 PECPRPELVRGLREHTDAGGIILLLQDEHVPGLEFSNDGGWIKIPPSKNNTIFVNTGDQVEVLSNGRYKSTLHRVMAGKD 237
255546169 161 PRCPQPELVRGLREHTDAGGIILLLQDDQVPGLEFLKDGEWVEIPPSKNNRIFVNTGDQLEVLSNGRYKSTLHRVMADKN 240
242096230 155 PRCSHPELVMGLREHTDAGGIILLFQDELVPGLEFLKDGKWIAIPPTEGNRIFVNLGDQIEVMTNGIYKSICHRVLPNKN 234
297832200 168 PECPRPELMRGLREHTDAGGIILLLQDDQVPGLEFFKDGKWFPIPPSKNNTIFVNTGDQLEILSNGRYKSVVHRVMTVKH 247
225444956 241 GSRLSIATFYNPSGDAIISPAPKLLYPDHFRFQDYLKLYATTKFADKGPRFESMKNMAIGHHS 303
15224803  248 GSRLSIATFYNPAGDAIISPAPKLLYPSGYRFQDYLKLYSTTKFGDKGPRLETMKKMGNADSA 310
224091345 238 GSRLSIATFYNPAGDAIISPAPKLSYPHNYTFQDYLKLYATTKFSDKGPRFEAMKKIANGHSS 300
255546169 241 GSRLSIATFYNPAGDAIISPAPKLLYPNNYTFQDYLKLYSTTKFLDKGPRFESMKKMTNGNGH 303
242096230 235 GSRLSIATFYNPGADAIIYPAPKLTYPSQYRFQDYLNFYSTTKFTDKVSRFQTTKAILK---- 293
297832200 248 GSRLSIATFYNPAGDAIISPAPKLLYPSGYRFQDYLKLYSTTKFGDKGPRLESMKKMGNADSA 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap