Conserved Protein Domain Family
PLN02402

?
PLN02402: PLN02402 
cytidine deaminase
Statistics
?
PSSM-Id: 178024
View PSSM: PLN02402
Aligned: 7 rows
Threshold Bit Score: 518.267
Threshold Setting Gi: 297832204
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255546161   1 MEPPRFVIEASEAESMAQKAGLTLVELLPTLVKSAQSLARPPISDYYVGAVGLGSSGRIFFGANLEFPGLPLHQSVHAEQ 80 
15224801    1 MDKPSFVIQSKEAESAAKQLGVSVIQLLPSLVKPAQSYARTPISKFNVAVVGLGSSGRIFLGVNVEFPNLPLHHSIHAEQ 80 
225444944   1 MERSRFVIEASEAESKAEKAGLTVMQLLPSLVNSAQKLARPPISKYHVGAVGLGSSGRIFLGVNLEFPGLPLNHSVHAEQ 80 
224088025   1 MDGPIFVIEASEAESMAKQSGLTVLQLLPALVKSAQALARPPISDYHVGAVGLGSSGRIFLGGNLEFPGLPLHHSVHAEQ 80 
224122466   1 MDGPIFVIEASEAESMAKQSGLTVLQLLPTLVKSAQALARPPISKYHVGAVGLGSSGRIFLGGNIEFPGLPLHHSVHAEQ 80 
224103399   1 MDGPIFVIEASEAESMAKQSGLTVLQLLPTLVKSAQALARPPISKYHVGAVGLGSSGRIFLGGNIEFPGLPLHHSVHAEQ 80 
297832204   1 MDKPSFVIQPKEAESAAKQLGVSVLRLLPSLVKPAQSYARTPISKFNVGVVGLGSSGRIFLGVNVEFPNLPLHHSIHAEQ 80 
255546161  81 FLITNLFLNAESNLKYVAVSAAPCGHCRQFFQEIRDAPDIQILITGDSNNTNNndQSNGDIKRFDTLSNLLPQRFGPYDL 160
15224801   81 FLVTNLTLNGERHLNFFAVSAAPCGHCRQFLQEIRDAPEIKILITDPNNSADS--DSAADSDGFLRLGSFLPHRFGPDDL 158
225444944  81 FLITNLSLKAETHLRCLAVSAAPCGHCRQFFQEIRDAPDIKVLITSSSD------------QEFRPLSEFLPNRFGPDDL 148
224088025  81 FLITNLTLNAEPSLKYIAVSAAPCGHCRQFLQEIRHAPDVQILITGDSTNNQSykNDLANKQQFEPLSCLLPHRFGPDDL 160
224122466  81 FLITNLTLNAEPSLKYVAVSAAPCGHCRQFFQEIRHAPDIHILITGDSNSNHNykNDLANEEQFEPMSCLLPHRFGPDDL 160
224103399  81 FLITNLTLNAEPSLKYVAVSAAPCGHCRQFFQEIRHAPDIHILITGDSNSNHNykNDLANEEQFEPMSCLLPHRFGPDDL 160
297832204  81 FLVTNLTLNGERHLKFFAVSAAPCGHCRQFLQEIRDAPEIKILITDPKNSADS--DSAADSDGFLRLGSFLPHRFGPDDL 158
255546161 161 LDKSVPLVLEKHNNHMSLQNDDisnnskKVPNGISISvFDDLKLEALEAANSSHAPYSKCPSGVALMDCEGKVYKGSYME 240
15224801  159 LGKDHPLLLESHDNHLKISDLD------SICNGNTDS-SADLKQTALAAANRSYAPYSLCPSGVSLVDCDGKVYRGWYME 231
225444944 149 LDKDTPLLLEPQNNGLSLVNAIgsqlvnTGCNGVCACdQDSLKYEALEAANKSHAPYSGCPSGVALIDSEGRVYRGSYME 228
224088025 161 LDKDIPLLLETRHNNLSFVGDA------LLPNGICAS-FDDLENEALEAANKSHAPFTNCPSGVALMDCEGKVYRGSYME 233
224122466 161 LGKDVPLLLEPHHNNLSFLGDD------KLPYGVSAA-LEDLKNEALEAAKKSHAPYTNCPSGLALMDCEGKVFRGSYME 233
224103399 161 LGKDVPLLLEPHHNNLSFLGDD------KLPYGVSAA-LEDLKNEALEAAKKSHAPYTNCPSGLALMDCEGKVFRGSYME 233
297832204 159 LEKDLPLLLEPHDNHLKISDLD------SIRNGITDS-SADLKQTALAAANRSYAPYSLCPSGVSLVDCDGKVYRGWYME 231
255546161 241 SAAYNPSLGPVQAAIVAYLVGG-GGGYEKIVAAVLVEKEEAVVRQEFTARLLLQVISPRCEFKVFHCSSS 309
15224801  232 SAAYNPSMGPVQAALVDYVANGgGGGYERIVGAVLVEKEDAVVRQEHTARLLLETISPKCEFKVFHCYEA 301
225444944 229 SAAYNPSLGPVQAALVAYIAGG-GDGYEEIVGAVLVEKEEAQVKQEQTARLLLNLISPKCEFRVFYCSSA 297
224088025 234 SAAYNPSIGPVQAALVAYVMGGrGGGYDRIVAAVLVEKQGAKARQEQTARLLLKEISPKCELKVFHCGSS 303
224122466 234 SAAYNPSMGPVQAALVAYVMGGrGGGFDRIVAAALVEKQGAQARQEQTARLILKEISPK----------- 292
224103399 234 SAAYNPSMGPVQAALVAYVMGGrGGGFDRIVAAALVEKQGAQARQEQTARLLLKEISPK----------- 292
297832204 232 SAAYNPSMGPVQAALVDYVANGgGGGYERIIGAVLVEKEDAVVRQERTARLLLETISPKCEFKVFHCYGA 301
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap