Conserved Protein Domain Family
PLN02399

?
PLN02399: PLN02399 
phospholipid hydroperoxide glutathione peroxidase
Statistics
?
PSSM-Id: 178021
View PSSM: PLN02399
Aligned: 6 rows
Threshold Bit Score: 402.356
Threshold Setting Gi: 224089376
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225430510   7 SVSFTAHSPGFAQTKAAHHHswpSSPYPSMAFLMPSTKSSFGASNSAFLRTGFSLCSSEIPGVSLKSRfSGGVYARAATE 86 
15224678    1 MVSMTTSSSSYGTFSTVVNS---SRPNSSATFLVPSLKFSTGISNFANLSNGFSLKSPINPGFLFKSR-PFTVQARAAAE 76 
22329066    1 ------MAFSYASFSTPFNGfaaNPSPITSAFLGPSLRFSTRTSKTRNPSNGVSVKSSNSHRFLVKSK-NFSVYARAAAE 73 
224089376   1 MASLPFSCSSVPGLKI-------HPNPTKMASFVTSIKSSLGPSKSAFLQRGFSLQSPNLPGFASKAR-SFGVFARAATE 72 
255548716   3 SVPLSSPFQSLTHFKINPNS---VSSSPSMAFFVPSVKSSLGSSKSAFLQHGFSLQLATSSGFFSKAR-SFCVSARAATE 78 
297821883   1 MVSMTTSSSSYAPFSTVFNS---SRPNSSATFLVPSFKFSTGISNFANLSNGFSLKSPINPGFLFKSR-PFTVQARAAAE 76 
225430510  87 KSLYDYTVKDIEKKDVPLSKFKGKVLLIVNVASKCGLTASNYSELSHIYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQ 166
15224678   77 KTVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKTQGFEILAFPCNQFGFQEPGSNSEIKQ 156
22329066   74 KSVHDFTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQLYEKYKNQGFEILAFPCNQFGGQEPGSNPEIKQ 153
224089376  73 KSVHDFTVKDINGKDVALSKFKGKALLIVNVASKCGLTSSNYSELTHIYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQ 152
255548716  79 KSIHEYTVKDIDGKDVPLSKFKGKALLIVNVASKCGLTSSNYTELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKN 158
297821883  77 KTVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKSQGFEILAFPCNQFGFQEPGSNSEIKQ 156
225430510 167 FACTRFKAEFPIFDKVDVNGPTTAPVYQFLKSNAGGFLGDLIKWNFEKFLVDKNGKVVERYQPTTSPFQIE--------- 237
15224678  157 FACTRFKAEFPIFDKVDVNGPSTAPIYEFLKSNAGGFLGGLIKWNFEKFLIDKKGKVVERYPPTTSPFQIE--------- 227
22329066  154 FACTRFKAEFPIFDKVDVNGPSTAPIYKFLKSNAGGFLGDIIKWNFEKFLVDKKGKVVERYPPTTSPFQIE--------- 224
224089376 153 FACTRYKAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVER-------------------- 212
255548716 159 FACTRYKAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTSPFQIEvyfffyfkn 238
297821883 157 FACTRFKAEFPIFDKVDVNGPSTAPIYEFLKSNAGGFLGGLIKWNFEKFLIDKKGKVVERYPPTTSPFQIE--------- 227
225430510 238 ----------------KDIQRLLAA 246
15224678  228 ----------------KDIQKLLAA 236
22329066  225 ----------------KDIQKLLAA 233
224089376     -------------------------    
255548716 239 ldifgtlvplnyheqyEGVMPLWSG 263
297821883 228 ----------------KDIQKLLAA 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap