Conserved Protein Domain Family
PLN02396

?
PLN02396: PLN02396 
hexaprenyldihydroxybenzoate methyltransferase
Statistics
?
PSSM-Id: 178018
View PSSM: PLN02396
Aligned: 3 rows
Threshold Bit Score: 644.095
Threshold Setting Gi: 224130454
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297826511   1 MLASKSMNQLQRLLLSARRLSSSQIIPPSCLLHQRLFSTSDTDSSAASFSSSHPKMQTLEGKASNKSRSTsSTTTSLNED 80 
15224587    1 MLASVRVNQLQRLLLSARRLSSSPIIPPSRLLHQRLFSTSDTDASAASFSSSHPKIQTLEGKASNKSRST-SSTTSLNED 79 
224130454   1 MALKLLSKLRNQNLQITRNRNHHRLVDAARFFSEQPVSNLSTPD---------------DSKFIIKNKQQ-TTTSSLKQH 64 
297826511  81 ELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIRSTLCRHFSKDPSSAKPFEGLRFIDIGCGGGLLSEPLARMGATVTGV 160
15224587   80 ELAKFSAIADTWWHSEGPFKPLHQMNPTRLAFIRSTLCRHFSKDPSSAKPFEGLKFIDIGCGGGLLSEPLARMGATVTGV 159
224130454  65 ELAKFAAISDTWWDSEGPFKPLHNMNPTRLAFIRSTLCRHFSKDPNCARPFEGLKIVDVGCGGGILSEPLARMGATVTGV 144
297826511 161 DAVDKNVKIARLHADMDPVTSTIEYLCTTAEMLADEGRKFDAVLSLEVIEHVANPAEFCKSLSALTIPNGATILSTVNRT 240
15224587  160 DAVDKNVKIARLHADMDPVTSTIEYLCTTAEKLADEGRKFDAVLSLEVIEHVANPAEFCKSLSALTIPNGATVLSTINRT 239
224130454 145 DAVEKNINVARLHADLDPETSTIEYCCTTAEKLVEEQRKFDAVIALEVIEHVAAPAEFCKSLAALAYPGGATVISTINRS 224
297826511 241 MRAYASTIVGAEYILRWLPKGTHQWSSFVTPEELSMILQHASVDVKEMAGFVYNPITGRWLLSDDISVNYIAYGTKRKDL 320
15224587  240 MRAYASTIVGAEYILRWLPKGTHQWSSFVTPEEMSMILQRASVDVKEIAGFVYNPITGRWLLSDDISVNYIAYGTKRKDL 319
224130454 225 MRAYATAIVAAEYLLNWLPKGTHQWSSFLTPEELVLILQRASINVKEMAGFVYSPLTGRWSLSDDISVNFIAYGTKDGQ- 303
297826511 321 GDI 323
15224587  320 GDI 322
224130454     ---    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap