Conserved Protein Domain Family
PLN02395

?
PLN02395: PLN02395 
glutathione S-transferase
Statistics
?
PSSM-Id: 166036
View PSSM: PLN02395
Aligned: 7 rows
Threshold Bit Score: 410.409
Threshold Setting Gi: 225446793
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15224581    1 MVLKVYGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQ 80 
15224582    1 MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQ 80 
225446791   1 MVVKVYGPAFACPKRVLICLVEKEIEFETVPVDIIKGEHKDPEYLKLQPFGVVPVIQDGDYTLYESRAIIRYYAEKYKSQ 80 
225446793   1 MVVKVYGPDFASAKRVLVCLIEKEVEFETLPIDIIKGQNKDPEFLKLQPFGVVPVIQDGDYTLFESRAIMRYYAEKYKSQ 80 
255578691   1 MVVKVYGPAYASPKRVLVCLIEKGIEFETVPVDLIKGEHRNPDFLKLQPFGALPVIQDGDYTLYESRAIIRYYAEKYKSQ 80 
297822799   1 MVLKVYGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQ 80 
297822801   1 MVLTIYAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRKPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQ 80 
15224581   81 GPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDF 160
15224582   81 GPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDF 160
225446791  81 GTDLLGKTIEERGTVEQWLEVEAQNYHPPIYNLVLHVLFSDKMGFPADAKVIEESEKNLGKVLDIYEERLSKSKYLAGDF 160
225446793  81 GTDLLGKTIEERGVVEQWLEVEAQSYHPAIDNLVIEILFGRKRGIPPDAKVIEESEKKLAKVLDIYEERLSKSKYLAGDF 160
255578691  81 GTDLLGKTIEERGLVEQWLEVEAQNYHPHVYNMTLHVLFASALGFTPDEKLIKESEEKIAKVLDIYEERLSKSKYLAGDF 160
297822799  81 GPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDF 160
297822801  81 GPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKESEEKLGEVLDVYEAQLSKNEYLAGDF 160
15224581  161 VSLADLAHLPFTDYLVGPIGKAYMIKDRKHVSAWWDDISSRPAWKETVAKYSFPA 215
15224582  161 VSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKYSLPV 215
225446791 161 FSLADLSHIPFTNYL-GAMGKMYLIKEREHVSAWWDDISSRPSWKKVLELYPAPI 214
225446793 161 FSLADLSHLPFTKYL-ADMGKMYLIEERKHVKAWWDDISNRPSWKKVFSS-RWPL 213
255578691 161 FSLADLSHLPFTQYLVGPMKRECMIKDRKYVSAWWDDISSRPSWKKVLELYRSF- 214
297822799 161 VSLADLAHLPFTDYLVGPIGKAYMIKDRKHVSAWWDDISSRPAWKETVAKYSFPA 215
297822801 161 VSLADLAHLPFTEYLVGPIGKAHLIKDRKHVSAWWDKISSRAAWKEVSAKYSLPV 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap