Conserved Protein Domain Family
PLN02392

?
PLN02392: PLN02392 
probable steroid reductase DET2
Statistics
?
PSSM-Id: 178015
View PSSM: PLN02392
Aligned: 7 rows
Threshold Bit Score: 453.113
Threshold Setting Gi: 224130766
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224130766   1 MALSDQSLFHYSLLTFYLLGPLTFVALKFFQLPYGRHHRLGWGFTVSPPLAWFLFETPSILLPLLLFPLGQHFTNLKALL 80 
15224430    2 EEIADKTFFRYCLLTLIFAGPPTAVLLKFLQAPYGKHNRTGWGPTVSPPIAWFVMESPTLWLTLLLFPFGRHALNPKSLL 81 
225440604   1 -MDWDRTLFHNSLIALYLIAPPTFISLRFLQAPYGKHHRSGWGPTVPPSLAWFLMESPTVWLTLLIYPLGDRSSNPRSLI 79 
224126689   1 MALLDQSFFHYSLLAYYLLGLPTFIALRFFQFPYGKHNRLGWGPTIPPPLAWFIMESPSILLPLILFPLGQHFTNPKALV 80 
224140367   1 MALLDQSLFHYSLLSIYLIGPPTFISLKFLQAPYGKHHRPGWGPTISPPLAWILMESPTLWLTLLLFPYGQHFTNPKAII 80 
255573889   1 MAFSDGSLFHKSLLALYLIGPPTFISLKFLQAPYGKHNRPGWGPTISPPLAWFLMESPTLWLTFLLFPFGQHASNPKAWV 80 
297827357   2 EEIADQTFFHYCLLTLIFSGPPTAVALKFLQAPYGKHNRTGWGPTVSPPIAWFVMESPTLWLTLLIFPFGRHALNPKSLL 81 
224130766  81 LMSPYLLHYFHRTCIYPLRVYHSTTQQNTKttsAVSVSMVLLAFMLQVLNTYLQTRWVSHYKHDYNsDGGLFWWKFFGGL 160
15224430   82 LFSPYLIHYFHRTIIYPLRLFRSSFPAGKN---GFPITIAALAFTFNLLNGYIQARWVSHYKDDYE-DGNWFWWRFVIGM 157
225440604  80 LISIYLFHYIHRTLIYPLHLRNSTAAKRN----GFPVSVALMAFGFNLLNAYLQARWVSHY-ANYE-DDGWFWWRFWVGL 153
224126689  81 LMSPYLLHYFHRTFIYPLRIYQSTSQQNTKttiGFPLILAFNGFLTQALNTYIQARWVSHYKSDYDsDGGLFWWKFFGGL 160
224140367  81 LMSPFLLHYFHRTCIYPLRIYRNSKTTG-----GFPVSVAVMAFGFNLLNAYLQARWVSHYKSDY--DGGLFWWKFFGGL 153
255573889  81 LMFPYLFHYFHRTCLYPLRLYWNTNQRNTKitsGFPVSMALLAFLFNFLNAYLQARWVSHYKEDYD-QDRWFWWRFWGGL 159
297827357  82 LFSPYLLHYFHRTIIYPLRLFRSSSAGKN----GFPITIAAMAFTFNLLNAYIQARWVSHYKDDYE-DGKWFWWRFIIGM 156
224130766 161 VVFLWGMRINMWADTVLLGLKREG-GGYKVPRGGWFELVSCPNYFGEMVEWLGWAVMTWSWAGFSFFLFTCSNLVPRACA 239
15224430  158 VVFITGMYINITSDRTLVRLKKENrGGYVIPRGGWFELVSCPNYFGEAIEWLGWAVMTWSWAGIGFFLYTCSNLFPRARA 237
225440604 154 VIFLDGMLVNVRSDLALVGLKSQG-GGYKVPRGGWFELVSCANYFGEVVEWLGWAVMTWSWVGLGFLLYTCANLVPRARA 232
224126689 161 VVFLWGMRINMWADTALLVLKRES-GGYKVPRGGWFELVTCPNYFGEIVEWLGWAVMTWSWAGFGFFLYTCSNLVPRACA 239
224140367 154 VVFVWGMRINTWADGVLLGLKREG-GGYKVPRGGWFELVSCPNYFGEIVEWLGWAVMTWSWAGFGFLLYTCANLVPRACA 232
255573889 160 VVFAWGMWTNVWSDRVLVRLKREG-DGYKVPRGGLFDLVSCPNYFGEIVEWLGWTLMTWSWVGFGFFLYTSANLVPRAVA 238
297827357 157 LVFVAGMYINITSDRTLVRLKKENrGGYVIPRGGWFELVSCPNYFGEVIEWLGWAVMTWSWAGIGFFLYTCSNLIPRAHA 236
224130766 240 HHKWYLKKFGEDYPNNRKAVIPFFI 264
15224430  238 SHKWYIAKFKEEYPKTRKAVIPFVY 262
225440604 233 NHKWYLEKFGEDYPKGRKAVIPFLY 257
224126689 240 NHKWYLQKFGEDYPKNRKAVIPFLV 264
224140367 233 NHKWYLEKFKEDYPRSRKAVIPFLC 257
255573889 239 NHKWYLDKFGKDYPRGRKAVIPFLY 263
297827357 237 SHKWYIEKFKEEYPKTRKAVIPFVY 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap