Conserved Protein Domain Family
PLN02386

?
PLN02386: PLN02386 
superoxide dismutase [Cu-Zn]
Statistics
?
PSSM-Id: 166027
View PSSM: PLN02386
Aligned: 12 rows
Threshold Bit Score: 248.284
Threshold Setting Gi: 225468294
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145323810   1 MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPDGKTHGAPEDANRHA 80 
115473931   1 MVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGKEHGAPQDENRHA 80 
115453035   1 MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAGKEHGAPEDETRHA 80 
15223944    1 MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPDGKTHGAPEDANRHA 80 
224130836   1 MVKAVAVLNSSEGVSGTIFFTQEGDGQTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPVGKEHGAPEDENRHA 80 
224125448   1 MVKAVAVLNSSEGVKGTINFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTGPHFNPVGKEHGAPEDENRHA 80 
225468294   1 MVKAVAVLNSNEGVCGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHA 80 
225468296   1 MVKAVAVLNSNEGVCGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHA 80 
225451120   1 MVKAVAVLNSNEGACGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHA 80 
225451122   1 MVKAVAVLNSNEGACGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHA 80 
255542450   1 MVKAVTVLGSSEGVKGTIFFTQEADGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHYNPAGKEHGAPGDENRHA 80 
297843670   1 MAKGVAVLNSSEGVKGTIFFTQEGDGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPDGKTHGAPEDANRHA 80 
145323810  81 GDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHADPDDLGKGGHELSLATGNAGGRVACGIIGLQG 152
115473931  81 GDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152
115453035  81 GDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152
15223944   81 GDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHADPDDLGKGGHELSLATGNAGGRVACGIIGLQG 152
224130836  81 GDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQG 152
224125448  81 GDLGNVTVGDDGTATVSIIDNQIPLTGPNSIVGRAVVVHADPDDLGKGGHELSKTTGNAGGRVACGVIGLQG 152
225468294  81 GDLGNVIVGEDGMYY-------IPLTGSNSIVGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGVIGLQG 145
225468296  81 GDLGNVIVGEDGTVNFKIVDLKIPLTGSNSIVGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGVIGLQG 152
225451120  81 GDLGNVIVGEDGTVNFKIVDKQIPLTGSNSIVGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGVIGLQG 152
225451122  81 GDLGNVIVGEDGTVNFKIVDKQIPLTGSNSIVGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGVIGLQG 152
255542450  81 GDLGNVTVGDDGTATFTIVDTQIPLSGPNSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQG 152
297843670  81 GDLGNITVGDDGTATFTITDTQIPLTGPNSIVGRAVVVHADPDDLGKGGHELSLATGNAGGRVACGIIGLQG 152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap