Conserved Protein Domain Family
PLN02383

?
PLN02383: PLN02383 
aspartate semialdehyde dehydrogenase
Statistics
?
PSSM-Id: 178009
View PSSM: PLN02383
Aligned: 17 rows
Threshold Bit Score: 549.373
Threshold Setting Gi: 219115203
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302770068   1 MALSENGPTVAVVGVTGAVGQEFLSVLDDRDFPYGKLKLLASKRSAGKHMTFQDRDYVVEELTDESFNGVDIALFSAGGS 80 
159473875  27 AAKTANGPRVAIVGITGAVGQEFLTVLTERNFPYSSMKMLASARSAGKKQEFEGVSYTIEELTENSFNDVDIALFSAGGS 106
145341457  39 AKRTADGPKVVIAGITGAVGQEFLRVLKERDFPYSEMKMLASARSAGSKVDFDGETYVVEELTESSFDGQDIALFSAGGS 118
219115203   1 -----MSYTVGIVGATGAVGQEIRNVLETRDFPVERLRIFGSARSAGSTVATKYGDVTVELFDVAAAKQCDVVFLAVSGD 75 
224147077   1 MALQENAPSLAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLTFQDRNYTIEELTEDSFDGVDIALFSAGGS 80 
224099567  32 MSLQENAPSLAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLTFQDRNYTIEELTEDSFDGVDIALFSAGGS 111
224111424  32 MALQENAPSLAVVGVTGAVGQEFLSVLSDRDFPYRSIKMLASKRSAGKQLTFQDRNYTIEELTEDSFDGVDIALFSAGGS 111
255070261  45 AAKDPSGPKVAIAGISGAVGQEFIRVLTERNFPYSEIKMLASSRSAGKEVEFDGETYVIEELTEDSFDGVDISLFSAGGS 124
255584961  34 MSLQETGPSLAVVGVTGAVGQEFLSVLSDRNFPYRSIKMLASKRSAGKQLTFQDKNYTVEELTADSFDGVDIALFSAGGS 113
303274204  42 ASKDSSGPKVAIAGVTGAVGQEFLRVLTERNFPYSRMKMLASARSAGKEVEFDGEMYKIEELKEDSFDDIDIALFSAGGS 121
302770068  81 ISKEFGP--VAVDKGVIVVDNSSAFRMVDGVPLVIPEasVNPDAMAHIRLSNKkGALIANPNCSTIICLMAVTPLHRHAK 158
159473875 107 ISKKLGP--IAAKAGAIVVDNSSAFRMTEGVPLVIPE--VNPEAMSHIKVGKG-GAIIANPNCSTIIALMAVTPLDRVAN 181
145341457 119 ISKKFGP--VAVEKGCFVVDNSSAFRMTDGVPLVIPE--VNPEAMAHLKLG-GkAGIIANPNCSTIIALMAVTPIHRAVG 193
219115203  76 FSLEHARhlTQGDDATVCIDNSSAFRYEADVPLVVPE--INGAETKKSK-------LIANPNCTTAIALMALWPLHQLFG 146
224147077  81 ISKHFGP--VAVEKGSVVVDNSSAFRMEEGIPLVIPE--VNPEAMEGIKVGTGkGALIANPNCSTIICLMAATPLHKHAK 156
224099567 112 ISKHFGP--VAVDKGAIVVDNSSAFRMEEGIPLVIPE--VNPEAMEGIKVGMGkGALIANPNCSTIICLMAATPLHRHAK 187
224111424 112 ISKHFGP--VAVEKGSVVVDNSSAFRMEEGIPLVIPE--VNPEAMEGIKVGTGkGALIANPNCSTIICLMAATPLHKHAK 187
255070261 125 ISKKFAP--IAAAKGCFVVDNSSAFRMADGVPLVIPE--VNPEAMADYKLGKKkGGIIANPNCSTIIALMAVTPIHRAVG 200
255584961 114 ISKEFGP--IAVDKGSIVVDNSSAFRMVEGVPLVIPE--VNPEAMKEIKFGLKkGALIANPNCSTIICLMAATPLHRHAK 189
303274204 122 ISKKFGP--IAAKKGCFVVDNSSAFRLTEGVPLIIPE--VNALSMAEYKLGKMhGGIISNPNCSTIIALVAVTPIHRAVG 197
302770068 159 VKRMVVSTYQAASGAGAAAMAELEQQTREVL-EGKEPTCKIFNQQYAFNLFSHNSSV-KENGYNEEELKLVKETRKIWD- 235
159473875 182 VKRMCVSTYQAASGAGAAAMEELRQQTRDVL-DGKPAQPKIFPQQYAFNLFSHNSGMdVALGYNEEEMKLVKETRKIWN- 259
145341457 194 VERIVVSTYQAASGAGALAMKELEQQTREVVnDGECKTMEIFQWQYAFNLFSHNAPM-TENGYNEEEMKMVKETRKIWD- 271
219115203 147 LKKVIMSTYQAASGAGQPGMDELTQGTQAYL-NGEAVENNIFAHPLPFNVIPQIDKF-QSNGYTKEEMKVTWETRKICGl 224
224147077 157 VIRMVVSTYQAASGAGAAAMEELELQTREVL-EGKPPTCNIFKQQYAFNLFSHNAPI-LSNGYNEEEMKLVKETRKIWN- 233
224099567 188 VQRMVVSTYQAASGAGAAAMEELELQTREVL-EGKPPTCNIFKQQYAFNLFSHNAPI-LSNGYNEEEMKLVKETRKIWN- 264
224111424 188 VIRMVVSTYQAASGAGAAAMEELELQTREVL-EGKPPTCNIFKQQYAFNLFSHNAPI-LSNGYNEEEMKLVKETRKIWN- 264
255070261 201 VKRMIASTYQAASGAGALAMAELEQQTRDVL-NNDPVTMNIFSWQYAFNLFSHNSPM-TENGYNEEEMKMVKETAKIWG- 277
255584961 190 VQRMVVSTYQAASGAGAAAMEELELQTREVL-QGKPPTCTIFKQQYAFNLFSHNAPV-QSNGYNEEEMKLVKETRKIWN- 266
303274204 198 IKRMVASTYQAASGAGALAMAELEQQTRDVL-NGDPVTMKIFNLQYAFNLFSHNAPM-TDNGYNEEEMKMVNETKKIWS- 274
302770068 236 DDEVRVTATCVRVPVMRAHAESINLQFEKPVDEETARQILSSANGVTVIDDRDANSFPTPLKVSSTDDVAVGRIRRDLSQ 315
159473875 260 NPGIRITATCVRVPVMRAHAESINLEFEKDISEAQALEALAAFPGVSIINDRQNNRFPTPLDATTKDNVFVGRVRRDISR 339
145341457 272 FKDVNITATCIRVPVMRAHAESINLTLKNPLDEVKAKEILSSAAGVSIIDDRAANRFPTPLDATDNDDVYVGRIRQDISQ 351
219115203 225 PDDFPLSCTAVRIPTIRAHSESIVVETERPVDVAAARQALAQAPGVKLVDNTEQLEYPMPQTATGQYDVEVGRLRKSIVY 304
224147077 234 DMNVKVTATCIRVPVMRAHAESVNLQFEKPIDEYTAKDILKSSPGVVVIDDPASNHFPTPLEVSNKDDVAVGRICRDVSQ 313
224099567 265 DMNVKVTATCIRVPVMRAHAESINLQFQQPLDEDTAKDILKSTPGVVVIDDRASNHFPTPLEVSNKDNVAVGRIRRDLSQ 344
224111424 265 DMNVKVTATCIRVPVMRAHAESVNLQFEKPIDEHTAKDILKSAPGVVVIDDRASNHFPTPLEVSNKDDVAVGRIRRDVSQ 344
255070261 278 TDAVSIAATCIRVPVMRAHAESINLTLCSELDEQDAKAILSKAPGISIIDDRANNRFPTPLDASNKDDVFVGRIRQDISQ 357
255584961 267 DMNVKVTATCIRVPVMRAHAESVNLQFEKPLDEDTARDILKNAPGVVVIDNRASNHFPTPLEVSNKDDVAVGRIRQDVSQ 346
303274204 275 TEDVDIAATCIRVPVMRAHAESINLTLCSDLDEKDAKEILRSSAGIKIIDDRANNCFPTPLDASNRDEIYVGRIRQDISQ 354
302770068 316 DGHHGLDIFVCGDQIRKGAALNAVQIAEKLW 346
159473875 340 DDNKGLDLFVCGDQIKKGAALNAVQIAELLL 370
145341457 352 PNNKGLDLFVCGDQIKKGAALNAVQCAELLL 382
219115203 305 -GDYGLELFVCGDQLLRGAALNAVLVAEEMV 334
224147077 314 DGYKGLDMFVCGDQIRKGAALNAIQIAEMLL 344
224099567 345 DGNKGLDIFVCGDQIRKGAALNAIQIAEMLL 375
224111424 345 DGYKGLDIFVCGDQIRKGAALNAIQIAEMLL 375
255070261 358 PGKSGLEIFVCGDQIKKGAALNAVQIAELIL 388
255584961 347 EGNHGLDIFVCGDQIRKGAALNAIQIAELLL 377
303274204 355 PGRTGLELFVCGDQIKKGAALNAVQIAELLL 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap