Conserved Protein Domain Family
PLN02382

?
PLN02382: PLN02382 
probable sucrose-phosphatase
Statistics
?
PSSM-Id: 178008
View PSSM: PLN02382
Aligned: 31 rows
Threshold Bit Score: 661.68
Threshold Setting Gi: 302771590
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168005724  39 RVGAKAIPKLMLVSDLDNTMVDHLDKSHTGLLRFNNLWAAEYAHNSLLVFSTGRSLEKYTQLRTQFPLLTPALCIFSVGT 118
30694025    1 MDRLEGPPRLILVADLDCTLVDHDDPENNDLLRFNALWEAHYRHDSLLVYCTGRSFSSYSSLRKKRPLLTPDIAVTSVGS 80 
168020892   1 -MEFKGSPRLLIVSDLDHTMVEHGDHDNKSLLRFGALWQSEFNHDSLLVYSTGRSPKMFADLRREVPLLTAGIAILSCGT 79 
168041898   1 -MVFSGAPRLMVVSDLDNTMVDHKDDSYTSLLRFGSLWQADYEHDSLLVYSTGRSPALYAELREEVPLITPGITIMSVGT 79 
168039984   1 -MEFTGAPRLLIASDLDHTMVEHGDHDNKSLLRFGALWQAHFSHDSLLVYSTGRSPKMFADLRGEVPLLTPAIAVLSCGT 79 
242086867   1 MEKLDASARLMIVSDLDQTMVDHDDPEDLSLLSFEALWEAEFSHDSLLIFSTGRSPISYNDLRKNKPLITPDITIMSVGT 80 
297820164   1 MDRLEGPPRLILVADLDCTLVDHDDPENTDLLRFNALWEAHYRHDSLLIYCTGRSFSSYMSLRKKRPLLTPDIAVTSVGS 80 
302809117   1 -MNLSSSPRLMIVSDLDHTMVDHHDPENKSLLRFNALWAAEFSHDSLLVFSTGRSPTLYKELRREKPLLTPGITILSVGT 79 
302806675   1 -MNLSSSPRLMIVSDLDHTMVDHHDPENKSLLRFNALWAAEFSHDSLLVFSTGRSPTLYKELRREKPLLTPGITILSVGT 79 
302771590   1 -------------------MVDHKDQTHSSLLDFASLWEAEYSRDCHLVFSSGRSPEKYLDLRRQVPLLTPDTIICSVGT 61 
168005724 119 EICY--GANMEPDQDWVNYLNEGWNQAVVLEEVKRL-NLRLQDDSEIRPHKVSCQIDKKDATEIIDTLSKRLKDRGLNVK 195
30694025   81 EIVYggGESTVSDVVWTARLDYKWNRDIVVEETLKFpKLEPQPDKSQEEHKVSFFVGREDAVEIMKVLPGILEERGVDVK 160
168020892  80 EIFY--GDTMTKDHGWIDIISKGWNRAAVEEVAEEM-NLKYQCDSEQRPHKVSFHVRKEESVHTMPTLLAKLLEKGLDIK 156
168041898  80 EIRY--GDTMEPDHGWEEELNQGWDREAIVEEGKKL-NLKFQVDSEQRPHKVSFYVDKAQADEVIKTLIERFKERQLNAK 156
168039984  80 EIFY--GDSMTEDDAWVDNINKGWSRAAVEEVANEM-NLKYQCDSEQRPHKVSFHVRKEEAKYVIPSLREKLLAKGLDIK 156
242086867  81 VIAY--GTDMVRDSDWEEHLNRNWDRDI--------------PEKDQGPHKVTFLVDKQGAQEVMHALPHNLKKRGIHVK 144
297820164  81 EIVYs-GESTVSDVVWTARLDYKWNRDIVVEETLKFpKLEPQPDKSQEEHKVSFFVEREDAVEIMKELPGILEERGVDVK 159
302809117  80 EIMY--GDSMIPDSGWEQELDKGWDRSIVMEVASEMpQLTFQSATEQRPHKVSFSVDRGQAPEIMKILDDRLKARGLEVK 157
302806675  80 EIMY--GDSMIPDSGWEHELDKGWDRSIVMEVASEMpQLTFQSATEQRPHKVSFSVDRSQAPEIMKVLDDRLKARGLEVK 157
302771590  62 EIRY--GPSMTPDNGWEEHLDEGWNREIIVEEAKKIaTLHFQEDSEQRPHKVSFKVEKKDAEEIIRRFSKNCDEQ-LDAK 138
168005724 196 LIFSHGIDLDVLPKGAGKGEALAFLLQKMRREGSAPQETLVCGDSGNDIELFEVEGVNGVIVGGAMEELRQWYDINGKHS 275
30694025  161 LVYSNGYAFDVLPRGAGKQGALTYLLDKLDIEGKQPSNTLVCGDSGNDAELFNISDVYGVMVSNSHEELLQWYEENAKDN 240
168020892 157 LIYSGGLDLDVLPRAAGKGQALRYLLQKLKAEGRVPQQTLVCGDSGNDQELFSVDNVCGVIVANAKDELLQWHADQVGDK 236
168041898 157 IIYSGGVDLDVLPTGAGKGQALEYLMKKLKAEGRAPGHTLVCGDSGNDAELFAVSDVYGVIVGNAMEELLKWHSEYQGDK 236
168039984 157 LIYSGGLDLDVLPRSAGKGQALRYLLNKLKAEGCVPQQTLVCGDSGNDQELFSVDNVFGVIVANAQDELLQWHANQVGDK 236
242086867 145 IIFSYGVLIDVVPQGAGKGQALQYLLNKFTLQRKAPNNILVCGDSGNDAELFSVPSVHGVMVSNAQEELLQWREENAMCN 224
297820164 160 LVYSNGYAFDVLPRGAGKQGALTYLLDKLDIEGNQPSNTLVCGDSGNDSELFNISQVYGVMVSNSHEELLQWHEENAKDN 239
302809117 158 LIHSGGQDLDVLPIGASKGHALSYLLKKFEAEGKSPLQTMVCGDSGNDAELFAVPGVYGSMVGNAMEELINWYNENARDN 237
302806675 158 LIHSGGQDLDVLPIGASKGHALSYLLKKFEAEGKSPLQTMVCGDSGNDAELFAVPGVYGSMVGNAMEELINWYNENARDN 237
302771590 139 LIYSGGIDLDVLPQRAGKGEALAYLMKKANSEGWAKERVLVCGDSGNDVELFTVKGVNGVIVGNAFDELVKWYSSQSSKD 218
168005724 276 SRLHLAKERCASGIVEAIGELSLGPHLSPFDRmnsngiqpavkASEKGQLT-----PSGVaQREVVEFNTFFTKWMNGEV 350
30694025  241 PKIFHASERCGAGMIEAIQRFNLGPNVSPRDVm----------DTENFHGE-----SLNP-AHEVVQFYLFYERWRCGEV 304
168020892 237 SHIFVATENCAAGIIEAMKHFGLEPNVSPRDRt----------VPLSVHDKlvpkaDAGAaAREVVEYLLLTEQWLRGDI 306
168041898 237 THIYLAKERCAAGILEAMQHFDLQPNVSPRLKf----------QAYDAASEl----SVSTvAHMVVEYLLLMEQWLKAVV 302
168039984 237 SHIFVSTEKCAAGIIEAMKHFNLQPNVSPRDCn----------VPLSVHCRripkaDPGAvAREVVEYLLLTEQWLRGDI 306
242086867 225 PKIIHSTKRCAAGVMQAIGHFKLGPNVSPRDL-----------ELPHPKLS-----IINP-ADLVVKFYVIYEKWRRGEV 287
297820164 240 PKIFHASERCGAGIIEAIQRFNLGPSVSPRDVl----------DSEIFQAE-----SLNL-AHEVVQFYLFYERWRCGEV 303
302809117 238 QKIFRATETCASGIIQGLQHFGIDPCVSPRDLem-------dgDFVAGDKD-----GHQAiAREIVLHQLLCEKWLKGEV 305
302806675 238 QKIFRATETCASGIIQGLQHFGIDPCVSPRDLem-------dgDFVAGHKD-----GHQAiAREIVLHQLLCEKWLKGEV 305
302771590 219 -HIHFASNRCAGGIIEALKFFDMGPALPPRERp------------GGNSNG-----AASP-RREIVDFYIFFDKWVKGDI 279
168005724 351 PNNPESFQRLTSVIASGSTMVYPWGVEQSLLQSVTSAQSKHGLTKDKKIRVWIDCIQEQELANGV--LMVTWHSWQMsEG 428
30694025  305 EKSDKYLQNLKSLSSPLGIFVHPSGVEKPIHEWIDEMENLYGDGKEKKFRIWLDNVTSSHISSDT--WLAKFVKHEL-SE 381
168020892 307 SASEEVFRRLKFGLAKDSSRVCAWGTIDSPHKEIENLQAQYGSQRGKVFHMWADRVRSMKLSDDS--WLVRFDKWER-SD 383
168041898 303 ENTDAVFNRLKASLAPDASYVHAYGIITNPHEEIDTMRELHGVKKNKPFFIWVDRIRIEQLSDTM--YLARFDKWEK-SS 379
168039984 307 DASEAAFRRLKFSLDKNSNRICARGIIDNPHEEIESLRNQHGSQKGKNFRIWADRVRSIKLSDDS--WLVRFDKWER-SD 383
242086867 288 EKSSSVIQYLKSIAHLNGTIIRPCGLEHSLHASIDALRSCYGDKKGKKFRAWVDRLVTSPMAMGTsnWLVKFDNWEM-EG 366
297820164 304 EKSDKYLQNLKSLSSPLGIFVHPSGVEKPIHEWIDDMEHLHGDGKEKKLRIWLDNVSSSHISSDT--WLAKFDKHEL-SE 380
302809117 306 ECNDHVFEILKAPVAPHSTLIGAWGVDIQLANAIEMLRPLHGLHKDKRFWIWVDRIRVTNIGKDT--WLAKFDKWQH-YD 382
302806675 306 ECSDHVFEILKAPVAPDSTLIGAWGVDIQLANAIEMLRPLHGLHKDKRFWIWVDRIRVTNIGKDT--WLAKFDKWQH-YG 382
302771590 280 PNTDEAFQRLTSVIAEDARMVYPWGEELNLLQSLAVVRGQHGAFQGKELRTWVDSIQEQELAPGV--YLATWQSWEQpSG 357
168005724 429 TERKGYFATAILREKEGTPNGVEWLRVHETPRKS 462
30694025  382 GKVRSCSTKVLLSYKE-EKQRLTWMHIHQSWLDE 414
168020892 384 AGLTCVLTSAVLQSNVEFPNGLCWKLIHETWLKG 417
168041898 380 SGLSCAITTALLQTKSDAPNGLLWKLIHETWLTG 413
168039984 384 AEWTCVLTSALLQANEEFPNGICWKLIHETWLQG 417
242086867 367 DARYCCHTTFLLNMKSDTPEGLELVHIDKSWLEG 400
297820164 381 GKVRSCSTKVLLSYKE-EKQRLTWMHIHQSWLDE 413
302809117 383 GELNCRITTAVFQSPE-GKPYATAIQIQETWKEG 415
302806675 383 WFFFFSVSLLVSK-----HRFFSRWRAQLSYNNR 411
302771590 358 ENRKGYYATAVFKDKKGAPNGVEWLRVHQTPQKQ 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap