Conserved Protein Domain Family
PLN02380

?
PLN02380: PLN02380 
1-acyl-sn-glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 178006
View PSSM: PLN02380
Aligned: 21 rows
Threshold Bit Score: 567.833
Threshold Setting Gi: 168003852
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225438273   1 MAIPAALAILPLGLLFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVEVFaADSETFE 80 
168003852 127 MEGGGSLIALPLGLMFIFSGLFINGLQVISVLFILPFSRRAYRVVNMIMMEALWSELVWLLDWWAGVKVKVY-TPRETSE 205
168024884   1 MEGGGSIIALPLGLMFLFSGFFINILQLLSVLFILPFSRRAYRVVNMIMMEVLWSELIWLLDWWANVKVSRL-SGSLSIS 79 
224055038   1 MAWPAVLVIVPVGIIFILSGLIVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIVLVDWWANLKIEVY-ADDETFE 79 
224106167   2 EKLATVVLFMPFGMVFCLTGVLITIIQAACFLIIWPLSRNTYRRIVGAVTEILFLEMIFLMDWLAGLEVRLH-TDLETYE 80 
255544852   1 MAIPAALAIVPIGILFFVSGFVVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIWLVDWWAHLKIEVY-ADDETFE 79 
302771714   1 --------------MFFCSGFVVNLLQVCSLVLL-PFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVRIY-ADEETRK 64 
302810293   1 MALLSALSVLPLGLMFFCSGFVVNLLQVCSLVLL-PFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVRIY-ADEETRK 78 
297852852   1 MKIPAALAFIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACIKINLY-ADAETLE 79 
297852854   1 MTIPAALVFIPVGILFLVSGLIVNSIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLSDWWACIKINLY-ADAETLE 79 
225438273  81 LMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIGWSMWFSDYVFVERSWAKDERTLKWGLERLE 160
168003852 206 HLGKERALVISNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKSTKFLPVIGWSMWFSEYVFLSRNWTKDEKVLKVLRCKLQ 285
168024884  80 LFGKEHALLICNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKSTKFLPVIGWSMWFSEYVFLSRDWAKDEKVLKNGYSSLK 159
224055038  80 LLGKEHALVISNHNSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGWSMWFSDYVFLERSWGKDERILQSGFERLA 159
224106167  81 LIGKENALVMPNHICDADVLIMWLLAERFNCLRGALMVMKKSSKYLPIYGWANWFNGAVFLNRNWAKDEGKLKSSFQELK 160
255544852  80 LMGKEHALLICNHRSDIDWLVGWILAQRSGCLGSALAVMKKQAKVLPIIGWSMWFSDYLFLERSWAKDETTLKSGFKRLE 159
302771714  65 HFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGWGMWFTEYIFLERKWEKDENTLKIGFQRWK 144
302810293  79 HFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGWGMWFTEYIFLERKWEKDENTLKIGFQRWK 158
297852852  80 LIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWFSDYIFLERSWAKDENTLKAGFKRLE 159
297852854  80 LIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMAKEAKYLPIIGWSMWFSDYIFLERSWAKDENTLKAGFKRLE 159
225438273 161 DFPRPFWLALF--------------VEGTRFTHTKLSAARQYAISSDLPIPSNVLIPRTKGFVAAVTHIRSFVPAVYDIT 226
168003852 286 -----LRIALLkhvclgvcaewlfkPEGLPKDLAKLEAARKYATEAGLRVPRHVLVPRTKGFVSAVENLREFVPAVYDMT 360
168024884 160 GFPRTLWVALF--------------VEGTRFTKAKLEAAQKFAADTGLRVPRHVLVPRTKGFVSAVENLREFVPVVYDMT 225
224055038 160 DFPMPFWLALF--------------VEGTRFTQAKLLAAQEFAASRGIPVPRNVLIPRTKGFVSAVTHLRSFVPAIYDAT 225
224106167 161 DFPGSFWLTIF--------------VEGTRITPDKLLAAQEFAILKGLPVPKNVLIPRTKGFVTAVQYMRPFVSAVYDVT 226
255544852 160 DFPMPFWLALF--------------VEGTRFTEAKLQAAQEYAVTRGLPIPRNVLLPRTKGFVSAVVHMRSFVPAIYDCT 225
302771714 145 NFPRVLWVALF--------------VEGTRFTEAKLKAAQEYAASAGLPVPRNVLVPRTKGFVCAVDNLRSFIPAVYDVT 210
302810293 159 NFPRVLWVALF--------------VEGTRFTEAKLKAAQEYAASAGLPVPRNVLVPRTKGFVCAVDNLRSFIPAVYDVT 224
297852852 160 DFPMTFWLALF--------------VEGTRFTQEKLEAAQDYASIRSLPSPRNVLIPRTKGFVSAVSQIRSFVPAIYDCT 225
297852854 160 DFPMTFWLALF--------------VEGTRFTQEKLEAAQDYASIRSLPSPRNVLIPRTKGFVSAVSQIRSFVPAIYDCT 225
225438273 227 VAVPRDQPSPTMLRILSGQSSV--------------------------VNLYIKRHTIQELPVTDAGIAQWCKDTF---- 276
168003852 361 VAVSKELPSPTMVRIFRGQPSVlillyilfpdvfalhqevltlwllgqVHVHVRWVPMSDLPQEANEISKWCHDAFeikv 440
168024884 226 VAISKELPNPTMIRIFRGQPSV--------------------------VHVHVRRVPMSDLPEGANAISKWCHDAF---- 275
224055038 226 VAVANSQPAPTFLRIFRGQSSV--------------------------IKVLLERHSMQELPETADGIAQWCKDAF---- 275
224106167 227 VAVPKGHPIPSVKRFFRRQPSV--------------------------VHFHIKRYATKGLPESDEGVAQWCKDRF---- 276
255544852 226 VDVDKSQPAPTMLRIFRRQSSV--------------------------INLQIKRHSMQEVPETADGISQWCKDVF---- 275
302771714 211 FALSKYKPAPTMTRILNRQSSV--------------------------VHMHVRRVPMNELPTEEEELTEWCREVF---- 260
302810293 225 FALSKYKPAPTMTRILNRQSSV--------------------------VHMHVRRVPMNELPTEEEELTEWCREVF---- 274
297852852 226 LTVHNNHPTPTLLRMFSGQSSE--------------------------VNLLMRRHKMSELPETDDGIAQWCQDLF---- 275
297852854 226 FTVHNNQPTPTLLRMFSRQSSE--------------------------VNLQMRRHKMSELPETDDGIAQWCQDLF---- 275
225438273 277 ------VAKDALLEQFFTTNTFGIQEYHNIG-RPKKSLFVVITWSCLLLLGLVKFFQWSL-LLSSWEGITSLLAFLVFIT 348
168003852 441 aleichMPNDDRLEQHEKENTFGEDLYIPIE-RPLKPLIFVISWAITLLAAAWWMLRP---IFSTWKGIAWVVGVLVVVM 516
168024884 276 ------HIKDDRLEQHEKENTFGEDLYIPIE-RPLKPLIIVISWAITLLAAAWWFLRR---VLSTWKGIAWVAGVLVVVM 345
224055038 276 ------VTKDAVLEKYFSKDIFRDKKLQDIG-RPKKSLFVMIFWSSLLAYATVRLFQWLSlFLASWEVITFSIAFLFLVT 348
224106167 277 ------VVKDAMLEEFRANDTFEGKEIRDFRiRPKKSLIAVIFLSCICSIGAIMFIQRFS-LLSNWKGISSLAFAVAFDA 349
255544852 276 ------VTKDAMLEKYHTKGTFSDQKHQHIG-RPKKSLFVVIFWSNLLIFGIVMSFQFLS-FLNSWQVLSFSVTLLVLVT 347
302771714 261 ------VRKDDLLDKHKAENTFGEELYVPLT-RSYKPLMIVIMWASLLTIAVVSLLAR---LLKSASGIAWFSGVLVSVT 330
302810293 275 ------VRKDDLLDKHKAENTFGEELYVPLT-RSYKPLMIVIMWASLLTIAVVSLLAR---LLKSASGIAWFSGVLVSVT 344
297852852 276 ------ITKDAQLEKYFTKDVFSDLEVHQIN-RPIKPLIVVIIWLCLLIFGGFKLLQWLS-IVASWKIILLFVFFLVIAT 347
297852854 276 ------ITKDAQLEKYFTKNVFSDLDVHQIN-RPIKPLIVVIIWLCLLIYGGFKLFQWLS-LVASWKIILLFVFFLVIAT 347
225438273 349 VIMHILIIFSQSERSDHVMVRSSDRLKEN 377
168003852 517 LCVQVLIMSSQSERSSDPTARRVKQKQAA 545
168024884 346 LCVQILVMSSQSERSSDPAAKKANQKQAA 374
224055038 349 IIMQILIQSSESERSTPA----------- 366
224106167 350 ILIYTFIEYTKLPEQGKAQATNGQVVKLH 378
255544852 348 IVMQILIHSSESEHSTPPPKLTFSDQAKE 376
302771714 331 ALMQVAILATQSERSTPAKRVNKGTHRN- 358
302810293 345 ALMQVAILATQSERSTPAKRVNKGTHRN- 372
297852852 348 ITMQVLIQSSESQRSTPAKRPLQEQLISA 376
297852854 348 ITMQVLVQTSESQRFTPAKRPLEEQLISL 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap