Conserved Protein Domain Family
PLN02379

?
PLN02379: PLN02379 
pfkB-type carbohydrate kinase family protein
Statistics
?
PSSM-Id: 178005
View PSSM: PLN02379
Aligned: 12 rows
Threshold Bit Score: 632.596
Threshold Setting Gi: 302769548
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168011889   7 ASGLENGGECGPRDIHLVCPDVVGLQPVALVDHVARVDWSLLESVPGERGGSMRVTEEELDHILREVNSHFLMSANGVVE 86 
168009151  33 VENGGCCDQNGALVHEVSHPAVVGLQPVALVDHVARVDWSLLEAVPGERGGSMRVTTEELDHILREVNSHFLMSTTDAAE 112
15223593    1 -------MVAEALPKCPEAPLVLGLQPAALIDNVAPVDWSLLDQIPGDRGGSIAVQKDELEHMLKELDAHISVAP----- 68 
115434030  13 PAPAPAPPTPVGRTDGDAPPMVLGLQLSALIDHVARVDWSLLNRIPGDRGGSQQVCIEELNHILAEVNAQILPCRDDLSS 92 
224066185   1 -------------------PLVLGLQPAALVDNVAHVDWSLLDQIPGDRGGSMPVAIEELEHILKEVKAHKLASPDELSP 61 
224082890   1 -------------------PLILGLQPAALVDHVAPVDWSLLDQIPGDRGGSMPVAIEELDHILEAVKAHKLASPDELSP 61 
242052389  10 QQPPSSLRPGREAAAAAAPPAVLGLQLSALIDHVARVDWSLLDRVSGDRGGSQQVSIEELNHILDEVNAHILPSRNDLTP 89 
225458233   1 MGAEPLLPKKTHTHTQPNSPLILGLQPSALIDHVAKIDSSLLAQIPGERGGSIAVAIEDLEHILNEVKTHILSSPPDPSP 80 
255538696   2 GAEALPRNIEIAPAAPPPPPLVLGLQPAALIDHVARVDWSLLDQIPGDRGGSIPVAIEELEHILREVETHMITSPDNASP 81 
297844934   1 -------MVAEALPKCPEAPLVLGLQPAALIDNVAPVDWSLLDQIPGDRGGSIAVQKDELEHILNELDTHISVAP----- 68 
302788828   1 ------MGAASCDGDGERNAVVVGLQPVALVDHVARVDWAMLESVPGERGGSIRVTATELEDILAQVNKHVLPNGDFSSP 74 
302769548   1 ------MGAASCDGDGERNAVVVGLQPVALVDHVARVDWAMLESVPGERGGSIRVTATELEDILAQVNKHVLPNGDFSSP 74 
168011889  87 qgVKTLAGGSVANTIRGLAHGLGVKTALVGVRGTDDRGEMFAENMAHAGVDLSRLRAVPGLTAQCACLVDAEGNRTMRPC 166
168009151 113 qrVKTLAGGSVANTIRGLAHGLCVKTALVGVRGIDDRGQMFAENMAHAGVDLSRLRAVPGMTAQCACLVDAEGNRTMRPC 192
15223593   69 --LKKMAGGSVTNTVRGLSVGFGVATGIIGAYGDDEQGQLFVSNMGFSGVSISRLRKKKGSTAQCVCLVDDSGNRTMRPC 146
115434030  93 --IRTIAGGSVANTIRGLSAGFGISTGIIGACGDDSQGVLFVSNMSFSGVDLTRLRTKKGHTAQCACLVDASGNRTMRPC 170
224066185  62 --MKTMAGGSVANTIRGLSAGFGVSCGIIGACGDDEQGKLFVSNMSFNGVNLSRLRMKQGHTAQCVCMVDELGNRTMRPC 139
224082890  62 --MKTMAGGSVANTIRGLSAGFGVSCGIIGACGDDEQGKLFVSNMSFSRVNLSRLRMKQGHTAQCICMVDELANRTMRPC 139
242052389  90 --ITTIAGGSVANTIRGLSAGFGISTGIIGACGDDNQGLLFVNNMSFSGVDLTRLRAKKGHTAQCVCLVDASGNRTMRPC 167
225458233  81 --MRTMAGGSVANTIRGLSAGFGVNCGILGACGDDEQGGLFVSNMGSSGVNLSALRIKKGPTAQCVCLVDALGNRTMRPC 158
255538696  82 --IKTIAGGSVANTIRGLSAGFGVSCGIIGAYGDDDEGKLFVSNMGFCGVNLSRLRRKIGPTGQCVCLVDALGNRTMRPC 159
297844934  69 --LKKMAGGSVTNTVRGLSVGFGVATGIIGAYGDDEQGQLFVTNMGFSGVSISRLRKKKGSTAQCVCLVDDSGNRTMRPC 146
302788828  75 --IRTLAGGSVANTLRGLAGGLGVRCKMVGARGNDEQGKMFATSMRSFQVDLSCLRVKSGPTGQCVCLVDALGNRTMRPC 152
302769548  75 --IRTLAGGSVANTLRGLAGGLGVRCKMVGARGNDEQGKMFATSMRSFQVDLSCLRVKSGPTGQCVCLVDALGNRTMRPC 152
168011889 167 FLNAVRLQSEELTGEDFKGAKWVVLNgYGFYGEDLLERAVDLCKEEGVKVSMDLASFEVVRNFRPTLMRLLESRKVDLVF 246
168009151 193 FLNAVRLQAEELTEKDFQGAKWVVLNgYGFYGEELLENAVDLCKKVGVKVSMDLASFEVVRNFRPTLMRLLESGKVDLVF 272
15223593  147 LSSAVKIQADELSKEDFTGSKWLVLR-YAVLNLQVIQAAIRFAKQEGLSVSLDLASFEMVRNSKSELRQLLESGNIDLCF 225
115434030 171 LSSAVKLQANEFKKEDFKGSKWLVVR-YARQNMEQILEAIRIAKQEGLSVSLDLASFEMVRDYRTQLIDLLETGNIDLCF 249
224066185 140 LSSAVKVQADELTKEDFKGSKWLVLR-YAIFNLEVIQAAIRNAKQEGLFVSLDLASFEMVRNFRSPLLQLLESGDIDLCF 218
224082890 140 LSSAVKIQADELTKEDFKGSKWLVLR-YAIFNLDVIQAAIRIAKQEGLLVSLDLASFEMVRNFRSSLQQLLESGDIDLCF 218
242052389 168 LSSAVKIQANEFRKEDFKGSKWLIVR-YAQQNMEQIIEAIRIAKQEGLSVSLDLASFEMVRDSRSKLINLLETGNIDLCF 246
225458233 159 LSSAVKIQAEELTKEDFKGVKWLVMR-YGIYNLEVIHAAIRMAKQEGVFVSLDLASFEMVRNFRGPLLELLQSGDIDLCF 237
255538696 160 LSSAVKVQANELINEDFKGSKWLVMR-YGIFNIEVIQAAIRIAKQEGLCVSLDLASFEMVRNFRLPLLQLLESGDIDLCF 238
297844934 147 LSSAVKIQADELSKEDFTGSKWLVLR-YAVLNLEVIQAAIRFAKQEGLSVSMDLASFEMVRNSRSELRQLLESGNIDLCF 225
302788828 153 LSDAVRLQASELTREDFKGIKWLVLNgYGFYGEELVESAAHLAKLEGALVSMDLASFEVVRNFRPRLLKLLQSRKVDLCF 232
302769548 153 LSDAVRLQASELTREDFKGIKWLVLNgYGFYGEELVESAAHLAKLEGALVSMDLASFEVVRNFRPRLLKLLQSRKVDLCL 232
168011889 247 ANEDEARELIKAEQNPCPETCLNFLSKYCERAVVMLGSKGCIARHGNETVRVPAIKETIAVDTTGAGDLFASGFLYGVLN 326
168009151 273 ANEDESRELIKAEANPCPEICLNFLSKYCERAVVMLGSKGCIARHGTETVRVPAIVETTTVDTTGAGDLFASGFLYGVLN 352
15223593  226 ANEDEAAELLRGEQEAGPEAALEFLGRHCRWAVVTLGSKGCIAKHDKEVVHISAIGETVATDATGAGDLFASGFLYGLIK 305
115434030 250 ANEDEARELLGGELTFDPEEALAFLAKYCKWAVVTLASKGCIAKHGKQVVQVAATGESNAVDATGAGDLFASGFLYGLVK 329
224066185 219 ANEDEAMELLRGEQTTDPEAAAEFLAKHCNWAVVTLAADGCIARHGKEIVRVPAIGEAKATDATGAGDLFAGGFLYGLIK 298
224082890 219 ANEDEAMELLRGEQTSDPEAAVEFLAKHCKWAVVTLGANGCIARHGKEIVRVPAIGEAKATDATGAGDLFAGGFLYGLIK 298
242052389 247 ANEDEAREVIGGGLESDPEEALAFLGKYCKWAVVTLASKGCMAKHGKQVVQVPAIGESNAVDTTGAGDLFASGFLYGLVK 326
225458233 238 ANEDEARELLRDDENASPEAALEFLAKHCQWAVVTLGSNGCLAKCGREMVRVAAIGEAKATDATGAGDLFAGGFLYGLVK 317
255538696 239 ANEDEAVELLRGEQKVDPEAALEFLAKHCNWAVVTLGSNGCIAKDKKEIVRVPAIGEANATDATGAGDLFASGFLYGLVK 318
297844934 226 ANEDEAAELLRGEQEAGPEAALEFLGRHCRWAVVTLGPKGCIAKHDKEVVQIPAIGETVATDATGAGDLFASGFLYGLIK 305
302788828 233 ANEDEARELMGGEPESTPESALKFLSQYCNNAVVMLGSKGCIARSGDEVVRAKAVEGGSVVDTTGAGDLFASGFLYGMIN 312
302769548 233 ANEDEARELMGGEPESTPESALKFLSQYCNNAVVMLGSKGCIARSGDEVVRAKAVEGGSVVDTTGAGDLFASGFLYGMIN 312
168011889 327 NFSLEDCCNMGCCTGGAVVRGLGGEVGEEGWEWMQQQLKFRKLSLIQHTT 376
168009151 353 NLSLEDCCKMGCCTGGAVVRGLGGEVGEEGWEWMRQQLKLRGLPSIDLAS 402
15223593  306 GLSLEECCKVGSCSGGSVIRALGGEVTPENWQWMHKQLQLKGLPVPDIHN 355
115434030 330 GLALEECCKVGACSGGSVVRALGGEVRPENWQWMYKQMNASGLLLPDLKN 379
224066185 299 GLSLEECCQVGACSGGSVIRSLGGEVTPENWQWMYKQMQIKDLPLPDIRN 348
224082890 299 GLSLEECCKAGACSGGSVIRALGGEVTPENWQWMYKQMQIKGLPLPDNRN 348
242052389 327 GLPLEECCKVGACSGGSVTRALGGEVRPENWQWMYKQMNARGLLLPELKN 376
225458233 318 GLSLEECCRVGTCSGGSVIRSLGGEVTPENWQWMYKQMQIKGLPVPGLRQ 367
255538696 319 GLTLEECCKMGACSGGSVVRSLGGEVTPENRQWMYKQLQVKGLPVPEIRN 368
297844934 306 GLSLEECCTVGSCSGGSVIRALGGEVTPENWQWMHKQLQLKDLPVPDIHN 355
302788828 313 GLSLDHCCKLGCCTGAAVVQDLGGEIKQQGKKWMLQNMASMGLPVFQA-- 360
302769548 313 GLSLDHCCKLGCCTGAAVVQDLGGEIKQQGKKWMLQKMASMGLPVFQA-- 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap