Conserved Protein Domain Family
PLN02378

?
PLN02378: PLN02378 
glutathione S-transferase DHAR1
Statistics
?
PSSM-Id: 166019
View PSSM: PLN02378
Aligned: 3 rows
Threshold Bit Score: 411.027
Threshold Setting Gi: 297850346
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15223576    1 MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQwFLDISPQGKVPVLKIDDKWVTDSDVIVGIL 80 
145323950   1 MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQ-FLDISPQGKVPVLKIDDKWVTDSDVIVGIL 79 
297850346   1 MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKNLTYKIHLINLSDKPQwFLDISPQGKVPVLKIDDKWVTDSDVIVGIL 80 
15223576   81 EEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYH 160
145323950  80 EEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYH 159
297850346  81 EEKYPDPPLKTPPEFASVGSNIFSTFGTFLKSKDSNDGSEQALLHELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYH 160
15223576  161 LQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP 213
145323950 160 LQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP 212
297850346 161 LQVALGHFKSWSVPASLPHVHNYMKDLFSLDSFEKTKTEEKYVISGWAPKVNP 213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap