Conserved Protein Domain Family
PLN02377

?
PLN02377: PLN02377 
3-ketoacyl-CoA synthase
Statistics
?
PSSM-Id: 166018
View PSSM: PLN02377
Aligned: 4 rows
Threshold Bit Score: 1055.39
Threshold Setting Gi: 297844920
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15223556    1 MDGAGEsrlggdgggdgsvgVQIRQTRMLPDFLQSVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQMNPDDLKQLW 80 
224132320   1 MDSGGE--------------IRIHQQRGLPDFLQSVNLKYVKLGYHYLISNLLTLCFIPLIIIISIESSQMNIKDLRQLW 66 
255538658   1 MDSGGE--------------IRIHQTRRLPDFLQSVNLKYVKLGYHYLISNLLTLCFIPLIIITSIEASQMNLDDLRHLW 66 
297844920   1 MDGAGEsrvgggg-gdgsvgVQIRQTRMLPDFLQSVNLKYVKLGYHYLISNLLTLCLFPLAVVISVEASQMNPDDLKQLW 79 
15223556   81 IHLQYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDSALEFQRKILERSGL 160
224132320  67 IHLQYNLVTVITCSAFLVFGFTVFIMTRPRPVYLIDYSCYRAPDHLKAPFNQFMEHSRLTGDFDDTSLEFQRKILERSGL 146
255538658  67 LHLQYNLVGIIICSAFLVFGLTVYIMTRPRPVYLVDYSCYRAPDHLKAPFGRFMEHSKLTGDFDESSLEFQRKILERSGL 146
297844920  80 IHLQYNLVSIIICSAILVFGLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFIEHSRLTGDFDDSALEFQRKILERSGL 159
15223556  161 GEDTYVPEAMHYVPPRISMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRS 240
224132320 147 GEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFTNTQVNPKSIGILVVNCSLFNPTPSLSAMIVNKYRLRGNIRS 226
255538658 147 GEDTYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGILVVNCSLFNPTPSLSAIIVNKYKLRGNIRS 226
297844920 160 GEDTYVPEAMHFVPPRISMAAAREEAEQVMFGALDNLFANTSVNPKDIGILVVNCSLFNPTPSLSAMIVNKYKLRGNIRS 239
15223556  241 YNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRL 320
224132320 227 FNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNESADKRKGKYKL 306
255538658 227 FNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRRRAKYKL 306
297844920 240 YNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENITQNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRL 319
15223556  321 VHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKP 400
224132320 307 VHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVVKKLLNKKMMP 386
255538658 307 VHVVRTHRGADDKAFRCVYQEQDDAGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVKKLFNKKMKP 386
297844920 320 VHVVRTHRGADDKAFRCVYQEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLFNGKVKP 399
15223556  401 YIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRRGNRVWQIAFGS 480
224132320 387 YIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKQRMQKGNRVWQIAFGS 466
255538658 387 YIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSSSIWYELAYVEAKRRMRKGNRVWQIAFGS 466
297844920 400 YIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRRGNRVWQIAFGS 479
15223556  481 GFKCNSAIWEALRHVKPSNNSPWEDCIDKYPVTLSY 516
224132320 467 GFKCNSAVWEALRDVKPSCNSPWEDCIDMYPVKLVA 502
255538658 467 GFKCNSAVWEALRNVKPSPNGPWEDCIDKYPVKLVV 502
297844920 480 GFKCNSAIWEALRHVKPSNNSPWEDCIDKYPVTLRY 515
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap