Conserved Protein Domain Family
PLN02376

?
PLN02376: PLN02376 
1-aminocyclopropane-1-carboxylate synthase
Statistics
?
PSSM-Id: 178004
View PSSM: PLN02376
Aligned: 2 rows
Threshold Bit Score: 1004.99
Threshold Setting Gi: 297848362
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15223414    1 MGLPGKNKGAVLSKIATNNQHGENSEYFDGWKAYDKDPFHLSRNPHGIIQMGLAENQLCLDLIKDWVKENPEASICTLEG 80 
297848362   1 MGLPAKNKGAILSKIATNDQHGENSEYFDGWKAYDKDPFHLSRNPHGIIQMGLAENQLCLDLIKDWVMENPEASICTLEG 80 
15223414   81 IHQFSDIANFQDYHGLKKFRQAIAHFMGKARGGRVTFDPERVVMSGGATGANETIMFCLADPGDVFLIPSPYYAAFDRDL 160
297848362  81 VHQFSDIANFQDYHGLKKFRQAIAHFMGKARGGKVTFDPERVVMSGGATGANETIMFCLADPGDVFLIPSPYYAAFDRDL 160
15223414  161 RWRTGVEIIPVPCSSSDNFKLTVDAAEWAYKKAQESNKKVKGLILTNPSNPLGTMLDKDTLTNLVRFVTRKNIHLVVDEI 240
297848362 161 RWRTGVEIIPVPCSSSNNFKLTVEAVDWAYKKAQESNKKVKGLILTNPSNPLGTMLDKDTLTNLVRFVTRKNIHLVVDEI 240
15223414  241 YAATVFAGGDFVSVAEVVNDVDISEVNVDLIHIVYSLSKDMGLPGFRVGIVYSFNDSVVSCARKMSSFGLVSSQTQLMLA 320
297848362 241 YAATVFAGGDFVSVAEVVNDVDISEVNVDLIHIVYSLSKDMGLPGFRVGIVYSYNDSVVSCARKMSSFGLVSSQTQLMLA 320
15223414  321 SMLSDDQFVDNFLMESSRRLGIRHKVFTTGIKKADIACLTSNAGLFAWMDLRHLLRDRNSFESEIELWHIIIDRVKLNVS 400
297848362 321 SMLSDDRFVENFLMESSRRLGIRHKVFTTGLKKADISCLTSNAGLFAWMDLRHLLRDRNSFESEIELWHIIIDKVKLNVS 400
15223414  401 PGSSFRCTEPGWFRICFANMDDDTLHVALGRIQDFVSKNKNKIVEKASENDQVIQNKSAKKLKWTQTNLRLSFRRLYEDG 480
297848362 401 PGSSFRCTEPGWFRVCFANMDDDTLHVALGRIQDFVSKNNNKIVEKASENDQVIQNNNAKKQNWRQSNLRLSFRRLYEDG 480
15223414  481 LSSPGIMSPHSPLLRA 496
297848362 481 LSSPGIMSPHSPLLRA 496
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap