Conserved Protein Domain Family
PLN02375

?
PLN02375: PLN02375 
molybderin biosynthesis protein CNX3
Statistics
?
PSSM-Id: 178003
View PSSM: PLN02375
Aligned: 3 rows
Threshold Bit Score: 491.198
Threshold Setting Gi: 15223367
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15223367    1 MISTLRRAVFLRRFPAVVSPIKRAFSSRIDDEFDPQIMNINELNQEMQSIFGQEPSPD---GPGTMDFSELKSSKIEPLR 77 
238478311   1 MISTLRRAVFLRRFPAVVSPIKRAFSSRIDDEFDPQIMNINELNQEMQSIFGQEPSPD---GPGTMDFSELKSSKIEPLR 77 
297848388   1 MISMLRRAVFLRRFPAVISPIKRAFSSKIHDEIDPQIMNIHELNQEMKSIFGEEPSPDgfsGPTTMDFSELK-SKIEPLK 79 
15223367   78 SKNI---DFRQQIEYHKSTHSSKNDSQAIEQYAKVASDMSKLTHVGIAGEAQMVDVSSKDNSKRTALACCKVILGKRVFD 154
238478311  78 SKNI---DFRQQIEYHKSTHSSKNDSQAIEQYAKVASDMSKLTHVGIAGEAQMVDVSSKDNSKRTALACCKVILGKRVFD 154
297848388  80 SANLensDFRSHIEYQKSTRSSKNDSQAIEQSAKVACDMSKLTHVGISGEAQMVDVSSKDNTKRTALACCKVILGKRVFD 159
15223367  155 LVLANQMGKGDVLGVAKIAGINGAKQTSSLIPLCHNIALTHVRVDLRLNPEDFSVDIEGEASCTGKTGVEMEAMTAVSVA 234
238478311 155 LVLANQMGKGDVLGVAKIAGINGAKQTSSLIPLCHNIALTHVRVDLRLNPEDFSVDIEGEASCTGKTGVEMEAMTAVSVA 234
297848388 160 LVLANQMGKGDVLGVAKIAGINGAKQTSSLIPLCHNISLTHVRVDLRLNPEDFSVDIEGEASCTGKTGVEMEAMTAVSVA 239
15223367  235 GLTVYDMCKAASKDISITDVRLERKTGGKSGSWSRL 270
238478311 235 GLTVYDMCKAASKDISITDVRLERKTGGKSGSWSRL 270
297848388 240 GLTVYDMCKAASKDISITDVRLERKTGGKSGYWSRG 275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap