Conserved Protein Domain Family
PLN02373

?
PLN02373: PLN02373 
soluble inorganic pyrophosphatase
Statistics
?
PSSM-Id: 178001
View PSSM: PLN02373
Aligned: 41 rows
Threshold Bit Score: 345.934
Threshold Setting Gi: 159473581
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159473581   1 MSFYRGTASHPWHDLHPGNDAPNFVSC----------------------------VIEIPRGSKVKYELDKDTGLCFVDR 52 
115448167  27 SMSQKHVAAHPWHDLEIGPGAPAVFNC----------------------------VVEIPRGSKVKYELDKATGLIKVDR 78 
168068108  31 TMERRTVAAHPWHDLEIGPAAPEIFNC----------------------------VVEINRGSKVKYELDKKSGLMKVDR 82 
168059949  20 SMERRTVAAHPWHDLEIGPAAPEIFNC----------------------------VVEINRGSKVKYELDKKSSLMKVDR 71 
168038586  32 GMERRTVAAHPWHDLEIGPEAPAIFNC----------------------------VIEIGKGSKVKYELDKKSGLIKVDR 83 
168016920  32 TMDRRSVAAHPWHDLEIGSDAPEIFNV----------------------------VIEINKGSKVKYELDKKSGLMKVDR 83 
255561090  25 SMSRRSVAAHPWHDLEIGPGAPSVFNC----------------------------VVEIGKGSKVKYELDKISGLIKVDR 76 
302765198  25 SLSRRSVAAHPWHDLEIGPGAPAVFNC----------------------------VVEISKGGKVKYELDKKSGLIKVDR 76 
302765294   1 -MADRFVAAHPWHDLEIGSGAPSVFNC----------------------------VVEIAKGSKVKYELDKQSGLIKVDR 51 
302776528   1 -MADRFVAAHPWHDLEIGTLVSCSLDSqavlaifsrdrascfvakpqallesvfqVVEIAKGSKVKYELDKQSGLIKVDR 79 
159473581  53 ILYSSVVYPHNYGFVPKTLCEDGDPLDVLVLMQEPVVPMCFLRAKPIGVMQMLDQGERDDKLIAVHADDPEYKGFTDISQ 132
115448167  79 VLYSSVVYPHNYGFIPRTLCEDGDPMDVLVLMQEQVVPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHFRDIKE 158
168068108  83 ILYSSVVYPHNYGFIPRTLCEDEDPIDVLVIMQEPVMPGSFVRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHFKDINE 162
168059949  72 ILYSSVVYPHNYGFIPRTLCEDEDPIDVLVIMQEPVMPGSFVRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHFKDINE 151
168038586  84 ILYSSVVYPHNYGFIPRTLCEDEDPIDVLVIMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHFKDIKE 163
168016920  84 ILYSSVVYPHNYGFIPRTLCEDEDPIDVLVIMQEPVLPGTFVRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHFKDINE 163
255561090  77 VLYSSVVYPHNYGFIPRTICEDSDPMDVLVLMQEPVLPGTFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKE 156
302765198  77 VLYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFTHYQDIKD 156
302765294  52 VLYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPVLPGAFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYKHCTDIKQ 131
302776528  80 VLYSSVVYPHNYGFVPRTLCEDNDPLDVLVIMQEPVLPGAFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYKHCTDIKQ 159
159473581 133 LPPHRLAEIKRFFEDYKKNEHKEVVVDDFLGAEEAKKVVKDSLNMYQEhYVPRKLRN 189
115448167 159 IPPHRLQEIRRFFEDYKKNENKEVAVNEFLPAEDAINAIKYSMDLYGA-YIIESLRK 214
168068108 163 LPPHRLAEIRRFFEDYKKNENKEVTVDNFLGHEAAIQAISHSMDLYAS-YIVESLRH 218
168059949 152 LPPHRLAEIRRFFEDYKKNENKEVTVDNFLGHEAAIQAISHSMDLYAS-YIVESLRQ 207
168038586 164 LPPHRLAEIRRFFEDYKKNENKSVAVDEFLGHEAAIDAIGHSMDLYAS-YIVESLRQ 219
168016920 164 FPPHRLAEIRRFFEDYKKNENKDVIVDNVFGHEAALQAISHSMDLYAA-YIVESLRQ 219
255561090 157 LPPHRLAEIRRFFEDYKKNENKKVDVEDFLPAEAAINAIKYSMDLYAS-YIVESLRQ 212
302765198 157 LPPHRLAEIRRFFEDYKKNENKTVAVNDFLPAENAVQAIQHSMDLYAS-YIVESLRQ 212
302765294 132 LPPHRLAEIRRFFEDYKKNENKQVEVEDFLPAEKAIEAVRNSMDLYAA-YVVETLRQ 187
302776528 160 LPPHRLAEIRRFFEDYKKNENKQVEVEDFLPAEKAIEAVRNSMDLYAA-YVVETLRQ 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap