Conserved Protein Domain Family
PLN02368

?
PLN02368: PLN02368 
alanine transaminase
Statistics
?
PSSM-Id: 177996
View PSSM: PLN02368
Aligned: 20 rows
Threshold Bit Score: 812.109
Threshold Setting Gi: 159480896
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255574001   1 MAPKALDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLSFPRQVVALCQAPFLLDDPNVGLL 80 
115470235   8 GGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVALCQAPFLLDDPNVGLI 87 
168061694   2 ASGKVMDPENLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMALCQAPFLMDDPHVGLL 81 
168022846   2 ASGKVMDPENLNLNVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMALCQAPFLMDDPHVGLL 81 
168049239   2 ASGKVMDPDNLNENVKKTVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMALCQAPFLMDDPHVGLL 81 
225470587   1 MSHKGLDYETLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVALCQAPFLLDDPNVGLV 80 
224102443   1 MAPRALDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVALCQAPFLLDDPNVGLF 80 
224110900   1 MAPRALDYESLNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVVALCQAPFLLDDPNVGLL 80 
302769650   1 MASKVLDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMALCQAPFLMDDPNVGLL 80 
302788734   1 MASKVLDPDNINENVKKCVYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQVMALCQAPFLMDDPNVGLL 80 
255574001  81 FPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIERRDGYPSDPELIFLTDGASKGVMQILNSIIRGEGDGVLV 160
115470235  88 FPADAIARAKHYLAMAPGGLGAYSDSRGIPGIRKEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILV 167
168061694  82 FPADAIAKAKHYLSMTSGGVGAYSDSRGLPGVRQEVANFILQRDGYPSDPENIFLTDGASKGVAQVLNALIRDEKDGVLV 161
168022846  82 FPEDAIARAKHYLAMTSGGVGAYSDSRGLPGVRQEVAEFILERDGYPSDVENIFLTDGASKGVAQVLNALIRNEKDGVLV 161
168049239  82 FPADAIAKAKHYLAMTSGGVGAYSDSRGLPGVRQEVANFILQRDGYPSDPENIFLTDGASKGVAQVLNALIRDEKDGVLV 161
225470587  81 FPADAIARAKHYLSLTSGGLGAYSDSRGLPGIRKEVAEFIGRRDGYPSDPELIFLTDGASKGVMQILNTIIRGERDGILV 160
224102443  81 FPADAIAKAKHYLAMTIGGLGAYTDSRGMPGVRKEVADFIERRDGYPSDPELIFLTDGASKGVMQILNTIIRGESDGILV 160
224110900  81 FPADAIAKAKHYLAMTTGGLGAYSDSRGMPGVRKEVADFIERRDGYPSDPELIFLTDGASKGVMQILSTIIRGESDGVLV 160
302769650  81 FPPDAVARAKHYLSMTSGGVGAYSDSRGLPGVRQEVAEFIQKRDGYPSDPEHIFLTDGASKGVMMMLNALIRNEKDGVLV 160
302788734  81 FPPDAVARAKHYLSMTSGGVGAYSDSRGLPGVRQEVAEFIQKRDGYPSDPEHIFLTDGASKGVMMMLNALIRNEKDGVLV 160
255574001 161 PVPQYPLYSAAISLFGGSLVPYFLEETANWGLDVNDLRQAVSQARAKGITVRAMVIINPGNPTGQCLSEDNLREILRFCY 240
115470235 168 PVPQYPLYSAAISLFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIKELLKFCF 247
168061694 162 PIPQYPLYSATIQLLGGTLVPYYLTEEENWGMSINELRRSVTEARRKGICVRGLVFINPGNPTGQCLTEKNLGELIEFCI 241
168022846 162 PIPQYPLYSATIQLLGGTLVPYYLTEEDNWGMDIKGLEKSVNEARRKGITPRGLVFINPGNPTGQCLSEKNLRGLIEFCI 241
168049239 162 PIPQYPLYSATIQLLGGTLVPYYLAEEDNWGLNTNDLRKSVTEARRKGICVRGLVFINPGNPTGQCLTEKNLRELIEFCI 241
225470587 161 PVPQYPLYSAAISLFGGSLVPYYLEETANWGLDVNNLHSSVAAARSKGITVRAMVIINPGNPTGQCLSEANLKEILHFCY 240
224102443 161 PVPQYPLYSAAISLFGGSLVPYFLEETANWGLDVNDLRQSVAQARSKGITVRAMVIINPGNPTGQCLSEANLREILHFCY 240
224110900 161 PVPQYPLYSAAISLFGGSLVPYYLEETENWGLDVNDLRQSVAQARYKGITVKAMVIINPGNPTGQCLSEANLREILRFCY 240
302769650 161 PIPQYPLYSASIALYGGILIPYYLNEESNWSLDFSDVRNQVVIARNKKIVPRALVFINPGNPTGQCLSVTNLQDLIKFCY 240
302788734 161 PIPQYPLYSASIALYGGILIPYYLNEESNWSLDFSDVRNQVVIARNKKIVPRALVFINPGNPTGQCLSVTNLQDLIKFCY 240
255574001 241 HEDLVLLGDEVYQQNIYQDERPFISSRKVLLDMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPAKTVDEIYKV 320
115470235 248 HENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGYWGECGQRGGYFEMTNLPPKTVDEIYKV 327
168061694 242 QERIVLMADEVYQQNVYQDERPFISARKVLMGMGPPASEALELVSFHTVSKGFLGECGQRGGYFEMTNFHPKTVDELYKV 321
168022846 242 RERVVLMADEVYQQNVYQDERPFISARKVLMGMGPRYSSALELVSFHTVSKGFLGECGQRGGYFEMTNFHPKTVEELYKV 321
168049239 242 KEKIVLMADEVYQQNVYQDERPFISARKVLMGMGPPVSEALELVSFHTVSKGFLGECGQRGGYFEMTNIHPKTVDELYKV 321
225470587 241 QENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPQTVDEIYKV 320
224102443 241 QENLVLLGDEVYQQNIYQDERPFISARKVLMGMGPPVSKEVQLISFHTVSKGYWGECGQRGGYFEMTNIPPKAVDEIYKV 320
224110900 241 QENLALLGDEVYQQNIYQDERPFISSRKVLMGMGPPISKEVQLVSFHTVSKGYWGECGQRGGYFEMTNIPPKTVDEIYKV 320
302769650 241 KERLLLMADEVYQVNVYQDERPFVSAKKVLMDMGAPYSNTVELVSFHSVSKGFLGECGQRGGYFEMTNIHPQTVEELYKV 320
302788734 241 KERLLLMADEVYQVNVYQDERPFVSAKKVLMDMGAPYSNTVELVSFHSVSKGFLGECGQRGGYFEMTNIHPQTVEELYKV 320
255574001 321 ASVSLSPNVPAQIFMGLMVNPLKPGDISYEQYVRESKGILESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFLxxswfRI 400
115470235 328 ASIALSPNVPGQIFMGLMVNPPKPGDISYLKFSAESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFP-----QI 402
168061694 322 SSIALSPNVSGQIMMGLMVNPPKPGDISYPQYEAESKAISLSLRKRAHIMTDGFNACENVVCNFTEGAMYSFP-----QV 396
168022846 322 ASIALSPNVTGQIMMGLMVKPPRPGDVSFPLYAAESAAIMQSLRKRAHIMTDGFNACENVVCNFTEGAMYSFP-----QV 396
168049239 322 SSIALSPNVTGQIMMGLMVSPPKPGDISYPLYKAESEAISLSLRKRAHIMTDGFNACENIVCNFTEGAMYSFP-----QV 396
225470587 321 ASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGILESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFP-----QI 395
224102443 321 ASVSLSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGILESLRRRARMMTDGFNSCRNVICNFTEGAMYSFP-----QI 395
224110900 321 ASVSLSPNVPAQIFMGLMVNPLKPGNISYEQFIRESKGIIESLRRRARMMTDGFNSCKNVICNFTEGAMYSFP-----QI 395
302769650 321 ASISLSPNVVGQIMMGLMVTPPRPFDISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFP-----RI 395
302788734 321 ASISLSPNVVGQIMMGLMVTPPRPFDISYPQYQAESKAIIESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFP-----RI 395
255574001 401 WTERRALPCRvfhlrttilpaeedmpaima----------------------------------sfkkfndefmeeyedh 446
115470235 403 RLPPKAIDAAkragkaadvfyclklleatgistvpgsgfgqkegvf---hlrttilpaeedmpaimtsfkkfndtfmdqy 479
168061694 397 KLPQAAVAAAkkagkapdvfyclrlleatgistvpgsgfgqkegtf--hvrttilpsekdmpgimesfkkfnqdfmaqya 474
168022846 397 KLPKAAIAAArqagkapdvfyclrlleatgistvpgsgfgqkegtf--hvrttilpsekdmpaimesfkmfnadfmaqys 474
168049239 397 KLPQAAIAAAkkagkapdvfyclrlleatgistvpgsgfgqkegtf--hvrttilpserdmpgimesfkkfnadfmaqhs 474
225470587 396 RLPPKAIEAAkkagkvadvfyclklleatgistvpgsgfgqkegvfhlrttilpaeedmpaimesfkkfndefmeqyedh 475
224102443 396 RLPPKAIDAAkmagkvpdvfyclklleatgistvpgsgfgqkegvfhlrttilpaeedmpeimdsfkkfndefmeqyegh 475
224110900 396 RLPPKAIEAAkkagkvpdvfyclklleatgistvpgsgfgqkegvfhlrttilpaeeempeimasfkkfnnefmeqyddr 475
302769650 396 KLSKAAMDAAaqagkaadvfyclklleatgistvpgsgfgqkegtlhlrttilpleqdmpgimakfqkfhadfmaqysdy 475
302788734 396 KLSKAAMDAAaqagkaadvfyclklleatgistvpgsgfgqkegtlhlrttilpleqdmpgimakfqkfhadfmaqysdy 475
255574001 447 rgysRM 452
115470235 480 dgysRM 485
168061694 475 daksKL 480
168022846 475 dsksKL 480
168049239 475 dtksKL 480
225470587 476 rgysRM 481
224102443 476 ggysRL 481
224110900 476 sgysRL 481
302769650 476 svssRL 481
302788734 476 svssRL 481
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap