Conserved Protein Domain Family
PLN02367

?
PLN02367: PLN02367 
lactoylglutathione lyase
Statistics
?
PSSM-Id: 177995
View PSSM: PLN02367
Aligned: 4 rows
Threshold Bit Score: 455.998
Threshold Setting Gi: 225436504
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255565419   1 MATAATLSSLLSRFTLIKPPIISQSSRRIQSILRYSKLKNPNRLRLFSMAsSEPKESPANNPGLYTTPDDATKGYIMQQT 80 
79317307    3 SYSIASAISRISPLIRFVKPYSTGFSFITCACNSTRRPKRFDQLCVFSMA-SEARESPANNPGLSTNRDEATKGYIMQQT 81 
225436504   3 SCSIATSLSRLSLLRLIPKPSSSYSSSIPLFPTTTRKDPSRFRLFSASMA-SEPKESPSNNPGLHSSPDEATKGYFMQQT 81 
297843598   3 SYSIAIAISRISPLIRFVKPYSTGFSFITCPCNSTRRPKRFDQLRVFSMA-SEARESPANNPGLSTVRDEATKGYIMQQT 81 
255565419  81 MYRIKDPKQSLDFYSHVLGMSLLKRLDFPEMKFSLYFMGYENTASAPTDPVERTVWTFGQKATIELTHNWGTESDPDFKG 160
79317307   82 MFRIKDPKASLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYEDTTTAPTDPTERTVWTFGQPATIELTHNWGTESDPEFKG 161
225436504  82 MYRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPSNETERIVWTFSQKATIELTHNWGTESDPDFKG 161
297843598  82 MFRIKDPKASLDFYSHVLGMSLLKRLDFSEMKFSLYFLGYEDTTTAPADPTERTVWTFGRPATIELTHNWGTESDPEFKG 161
255565419 161 YHNGNSEPRGFGHIGITVDDVYKACERFKSLGVEFVKKPEDGKMKGIAFIKDPDGYWIEIFDLKTIGKTTGSAA 234
79317307  162 YHNGNSEPRGFGHIGVTVDDVHKACERFEELGVEFAKKPNDGKMKNIAFIKDPDGYWIEIFDLKTIGTTTVNAA 235
225436504 162 YHNGNSEPRGFGHIGITVDDTYKACERFERLGVEFVKKPDDGKMKGLAFIKDPDGYWIEIFDLRRIGTVSTTAA 235
297843598 162 YHNGNSEPRGFGHIGVTVDDVHKACERFEELGVEFVKKPNDGKMKNIAFIKDPDGYWIEIFDLKTIGTTTVNAA 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap