Conserved Protein Domain Family
PLN02365

?
PLN02365: PLN02365 
2-oxoglutarate-dependent dioxygenase
Statistics
?
PSSM-Id: 177993
View PSSM: PLN02365
Aligned: 11 rows
Threshold Bit Score: 525.896
Threshold Setting Gi: 115458950
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297849814   1 MAEVNgvipsykksgvIPTIDLEEV---NDQIlnQKIRQASEKWGCFTVINHGVSLSLMAEMKKTVRDLHERPHEMKVRN 77 
15223094    1 MAEVNg---------vIPTIDLEEV---NDQIlnEKIREASERWGCFTVINHGVSLSLMAEMKKTVRDLHERPYEMKLRN 68 
15223096    1 MGELNgv--------iIPTIDLEEV---SDKIlnQKIREASERWGCFRVINHGVSLSLMAEMKKTVIDLFQRPYEVKVRN 69 
115458950   1 MVE-------------IPAIDLRLAgggGGAEetARLRDACARLGCFRVSGHGVPPGLQAEMKAAVRALFDLPDDAKRRN 67 
224056727   1 MGESG-----------VPTIDLQEF---PGQY--EKLRRACEEWGCFRLVNHNISLALMADMKRVVRSLLDLPFDVKKRN 64 
224117676   1 MGKSG-----------VPIIDLHEF---PGQY--EKLRRACVEWGCFRIVNHNISLALMADMKRVVRSLLDLPFDVKKRN 64 
242076198   1 MAE-------------IPVIDLRLAgssREES--ARLRAACERLGCFRVTGHGVPAGLLAEMKAAVRALFDLPDDAKRRN 65 
242065142   1 MAE-------------IPVIDLRLAgsaAEES--ARLRAACERLGCFRVTGHGVPAGLLAEMKAAVRALFDLPDDAKRRN 65 
225431637   1 MAAGD-----------IPSIDMQDF---PRQF--RRLREACEEWGCFRVVNHSIPPSLLSEMKSVVGSLLDLPLEVKRRN 64 
255575269   1 MEKTV-----------VPTIDVSDF---PGEY--ERLRKACEEWGCFRAVNHNIPSALMSEMKKVVRSLLDLPMEVKVRN 64 
297849816   1 MEELNg---------vIPTIDLEEV---SDKIlnQKIREASERLGCFRVINHGVSLSLMAEMKKTVIDLFQRPYEVKLRN 68 
297849814  78 TDVLLGSGYKPLSELNPFYESFGSFDMASPQAVNNFCDQLDASADQREIMLKYAKATDDLARNLARRLAESYGVV-DQHF 156
15223094   69 TDVLLGNGYKPLSEFNPFYESFGLFDMASPQAVNSFCDKLDASPDQREILLKYAKATDDLARSLARRLAESYGVV-EPNF 147
15223096   70 TDVLLGSGYRAPNEINPYYEALGLYDMASPHAVNTFCDQLEASADQREIMVKYAKAINGLATDLARKLAESYGLV-ETDF 148
115458950  68 ADIIPGSGYVPPGTANPLYEAFGLCDAAAPADVDAFCARLDAPPHVRETVKAYAERMHSLIVDVAGKVAASLGL--HGAS 145
224056727  65 LDVISGSGYMAPSQVNPLYEALGLYDMGSSQAVETFCSQLDASSYQREVIEMYAKAIHGVAKDVARKLAESLGL--SGDF 142
224117676  65 IDVIAGSGYMAPSKVNPLYEALGLYDMRSSQAVETFCSQMDASPYQREVIEMYAKAIHGAAMDIARKLAESMGL--NGDL 142
242076198  66 ADVIPGSGYVPPSAANPLYEAFGLLDAAAPADVDAFCARLDAPPHVRETVKAYAEKMHDVIVGVAGELASSLGL--EKHS 143
242065142  66 ADVIPGSGYMAPSPTNPLYEAFGLLDAAAPADVDAFCALLDAPPHVRETIKTYAEKMHDVIVAVAGELASSLGLVaEEHS 145
225431637  65 TDVIAGSGYMAPSKVNPLYEALGLYDMASHQAVDAFCSQLDASPHQRETIKIYAKAVQELAMDIGNKLAETMGL--GGDL 142
255575269  65 SDVIAGSGYMAPSPVNPLYEALGLYDIGSSQAVHTFCSQVDASPHQREVISNYAKAIHELSMDLAWKLAQSMGLL-SNDL 143
297849816  69 TDVLLGSGYRAPNEINPYYEALGLYDMASPQVVNTFCDQLEASADQREIMVKYAKAINGLSMDLVRRLAESYGLV-ETDF 147
297849814 157 LRGWPSHFRMNKYHFKPEA-VGKLGVRLHTDPGFLTILQGDEDVGGLEAMDNSSGSFFPINTLPNTLLVNLGDMATIWSN 235
15223094  148 LRGWPSQFRMNKYHFKPDS-VGKLGVILHTDPGFLTILQGDEDVGGLEAMDNSSGSFFPIHTLPNTLLVNLGDMATIWSN 226
15223096  149 FKEWPSQFRINKYHFKPET-VGKLGVQLHTDSGFLTILQDDENVGGLEAMDNSSGTFFPIDPLPNTLAINLGDMATIWSN 227
115458950 146 FQDWPCQFRMNRYNYTQDS-VGSPGVQVHTDSGFLTVLQEDECVGGLEVLDPAAGEFVPVDPLPGSFVVNVGDVGQAWSN 224
224056727 143 FESWVCQFRINKYNFTPET-IGSSGVQIHTDSGFLTILQDDKNVGGLEVMNP-SGVYVAVDPVPGTLLINLGDIAKAWSN 220
224117676 143 FESWISQFRINKYSFTPET-IGSSGVQIHTDSGFLTILQDDENVGGLEVMDP-SGVFAAVDPSPGTLLVNLGDVATAWSN 220
242076198 144 FQDWPCQFRINRYNYTQET-VGSSGVQTHTDSGFLTVLQEDECVGGLEVLDPATGEFVPVDPVAGSFVVNIGDVGTAWSN 222
242065142 146 FQDWPCQFRINRYNYTHETvVGSSGVQIHTDSGFLTVLQEDERVGGLEVLDPATGEFVPVDPVAGSFLVNIGDVGTAWSN 225
225431637 143 FKEWPCQFRINKYNFTPET-VGSPGVQIHTDSSFLTILQDDENVGGLEVMDK-SGAFVAVDPMPGTLLVNLGDIATVWSN 220
255575269 144 FEGWPSQFRINKYNFTSET-VGSSGVQIHTDSGFLTILQDDEDVGGLEVMDR-SGAFVAVDPLPGTLLVNLGDVATAWSN 221
297849816 148 FKGWPSQFRINKYHFRPET-VGKLGVQLHTDSGFLTILQDDENVGGLEAMDSSSGTFFPIDPLPNTLAINLGDMATIWSN 226
297849814 236 GRLCNVKHRVQCIEAKMRITTATFLLGPVDRDLEAPDEFVDAEHPRLYKPISDGGLRKIRLSKHLHAGESLKFITIKD 313
15223094  227 GRLCNVKHRVQCIEAKMRITIASFLLGPVDRDLEAPDEFVDAEHPRLYKPISDGGLRKIRLSKHLHAGESLKFITINE 304
15223096  228 GRLCNVKHRVQCKEATMRYSIASFLLGPMDTDLEPPSEFVDAEHPRLYKPISHEGVRNIRMTKKLHDGEALKLITHAG 305
115458950 225 GRLHNVKHRVQCVAAVPRVSIAMFLLAPKDDTVSAPGELVDGEHPRRYREFKYDDYRRLRLSTGERAGEALARLAA-- 300
224056727 221 GRFRNVQHRVQCKEATIRISIASFLLAS-DEEVEAPPELVDSEHPRLYVPFTYEDYRKLRLTTKLQAGEALELKRIKS 297
224117676 221 GGLRNVQHRVQCKEATIRISIASFLVGPKD-EVEAPPELVDSEHPRLFVPFKYEDYRKLRLTTKLEAGEALELKRILS 297
242076198 223 GRLHNVKHRVRCVAPVPRISVAMFLLAPKDDGVSAPEAFVDEDHPRRYKAFNYDDYRRLRLSTGERAGEALARMAA-- 298
242065142 226 GRLHNVKHRVRCVAPVPRISIAMFLLAPKDDGVSAPEAFVDADHPRRYKAFTYGDYRKLRLSTGEHAGEALARMAA-- 301
225431637 221 GRLCNVKHRVQCKEAAVRLSIASFLLGPKDAAVEAPPELVDSEHPRLFVPVTYEDYRKLRLSTKLQAGEALALVRVDS 298
255575269 222 GRLCNVKHRVQCKQAAVRISIASFLLGPKDSAVEAPPELVDSQHPRLYIPFTFQDYRKLRLRTKFQAGEALELMLASS 299
297849816 227 GRLCNVKHRVQCKEATMRYSIASFLLGPMNTDLEPPSEFVDAEHPRLYKPISHEGIRNIRMTKKLHDGEALKLITHEG 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap