Conserved Protein Domain Family
PLN02361

?
PLN02361: PLN02361 
alpha-amylase
Statistics
?
PSSM-Id: 177990
View PSSM: PLN02361
Aligned: 9 rows
Threshold Bit Score: 765.129
Threshold Setting Gi: 168067856
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168000555   1 MTEDDLIQRGREILFQAFNWESHKQPWWNLLKGRVDEMAEWGFTSLWLPPPWDSLAPQGYLPRDLYSLNTPYGKDGELRD 80 
15222959   15 TDIGRVIRDGREVILQAYNWESHKYDWWRNLDGKVPDIAKSGFTSAWLPPPSQSLAPEGYLPQDLYSLNSAYGSEHLLKS 94 
115458194  44 ARNGGIIKHGREILFQAFNWESHKHNWWSNLEEKVVDLAQSGFTSAWLPPPTQSLSPEGYLPQNLYCLDSCYGSLHDLQA 123
168067856   1 ---MAIISF---ILAQGFNWESHKQQWWRSLKRKVSELAGWGFTSLWLPPVCDSLAPQGYLPKNLYNLNSAYGSEVELRS 74 
225459795  62 SDYGAVLRNGREILLQGFNWESHKHDWWRNLEKKVPDVAKSGFTSVWLPPASQSFSPEGYLPQNLYSLNSSYGSEHLLKN 141
242072900  15 ARDGGIIKNGREILFQAFNWESNKHNWWRNLEEKVTDLAESGFTSVWLPPPTQSLSREGYLPQNLYCLDSCYGSLHELKS 94 
224065715   8 TDNGAVLRSGREILLQAFNWESHKHDWWRKLEKKVADIAKSGFTTAWLPPPTNSFAPEGYLPQNLYNLNSSYGSEQLLKA 87 
255539112   1 -MQGAAVRNGKEILLQAFNWESHKHDWWRNLERKVPDIAKSGFTSAWLPPPSQSLSPEGYLPQNLYSLNSVYGSEHLLKA 79 
297839489  15 TDIGRVLRDGREVILQAYNWESHKHDWWRNLDGKVPDIAKSGFTSAWLPPPSQSLAPEGYLPQDLYSLNSAYGSEHLLKS 94 
168000555  81 LVRKINERGIRAMADIVINHRIGSCQGYAGRYNRYDGMPMPWDEHAVTCDTFGLGNPKTGVIFEGVPNLDHTQEFVRNDL 160
15222959   95 LLRKMKQYKVRAMADIVINHRVGTTRGHGGMYNRYDGISLPWDEHAVTSCTGGLGNRSTGDNFNGVPNVDHTQHFVRKDI 174
115458194 124 LLRKMKEHNVRAMADVVINHRVGTTQGSNGMYNRYDGIPVSWDEHAVTSCSGGKGNESTGDNFDGVPNIDHTQPFVRKDI 203
168067856  75 LLQHMKKSGLKPMADIVINHRVGSTRGKGDLYNRYDGLPMPWDEYAVSSDTGGLGKPSTGEIFKGVPNLDHSSEVVANDL 154
225459795 142 LLQKLNQHKVRAMADIVINHRVGTTQGHGGMYNRYDGIPLSWNEHAVTSCTGGLGNRSSGANFHGVPNIDHTQNFVRNDL 221
242072900  95 LLHKMSEHNVRAMADVVLNHRIGTTQGSNGMYNRYDGIPISWDEHAVTSCSGGKGNKSTGDNFDGVPNIDHTQPFVRKDI 174
224065715  88 LLEKMKQYNVRAMADIVINHRVGTTQGHGGMYNRYDGVPLSWDERAVTSCTGGLGNRSTGDNFNGVPNIDHTQHFVRKDI 167
255539112  80 LLQKMKQYNVRAMADIVINHRIGTTKGHGGMYNRYDGIPIPWDERAVTLCTGGLGNRSTGDNFNGVPNIDHTQHFVRKDI 159
297839489  95 LLRKMKQYKVRAMADIVINHRVGTTRGHGGMYNRYDGISLPWDEHAVTSCTGGLGNRSTGDNFNGVPNVDHTQHFVRKDI 174
168000555 161 KGWMHWVRNDLGFKDFRFDFSKGYAPRFVREFIDAAQPYLSIGEYWDSCRYSGSDwsLDYNQDAHRQRTVNWIDGCIGAA 240
15222959  175 IGWLRWLRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHG--LDYNQDSHRQRIISWIDATGQIS 252
115458194 204 IDWLIWLRESIGFQDFRFDFTKGYAAKFVKEYIEQSKPLFAVGEYWDSCEYSPPDyrLNYNQDKHRQRIINWMDSTGGLC 283
168067856 155 KNWLEWMRKDVGFECFRFDYAKGYSPKFVKAYIEASKPRLAIGEYWDTCKYIGPNylLDYNQDAHRQRTVDWIDGTGGLS 234
225459795 222 IGWLKWLRG-VGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDPCNYNNNG--LDYNQDSHRQRIVNWIDGTGQLS 298
242072900 175 IEWLIWLRKSVGFQDFRFDFTKGYAAKFVKEYIEESKPLFAVGEYWDSCEYSPPDyrLNYNQDSHRQKIINWIDNTGGLC 254
224065715 168 TAWLQWLRKNVGFQDFRFDFARGYSPKYVKEYIEGAKPIFSVGEYWDSCNYNGHF--LEYNQDSHRQRIVNWIDLTGQLS 245
255539112 160 IGWLKWLRNVVGFQDFRFDFARGYSAKYVKEYIEAAKPIFSIGEYWDSCNYSGTY--LEYSQDSHRQRIVNWIDCTGQLS 237
297839489 175 IGWLRWLRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHG--LDYNQDSHRQRIISWIDATGQIS 252
168000555 241 CAFDFTTKAILQEAVgRRQWWRLRDGQGRPPGVIGMWPSRAVTFIDNHDTGSTQGFWPFPWDHVAQGYAYILTHPGQPCV 320
15222959  253 AAFDFTTKGILQEAV-KGQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQAHWPFPSHHVMEGYAYILTHPGIPCV 331
115458194 284 AAFDFTTKGILQEAV-KGELWRLRDPEGKPPGVMGWWPSRSVTFVENHDTGSTQGHWPFPSDHIMEGYAYILTHPGIPTV 362
168067856 235 CAFDFTTKAILQEACaKEEWYRLRDAQGRPPGLLGVWPSRAVTFIDNHDTGSTQAHWPFPRNCVAQGYAYILTHPGQPCV 314
225459795 299 AAFDFTTKGILQEAV-KGQFWRLRDRQGKPPGVMGWWPSRAVTFIDNHDTGSTQAHWPFPMNHLMEGYAYILTHPGIPTV 377
242072900 255 AAFDFTTKGILQEAV-KGELWRLRDPEGKPPGVMGWWPSRSVTFIENHDTGSTQGHWPFPSDHIMEGYAYILTHPGIPTV 333
224065715 246 AAFDFTTKGILQEAV-KGQFWRLRDPQGKPPGVLGWWPSRAVTFIDNHDTGSTQAHWPFPSDHIMEGYAYLLTHPGMPTV 324
255539112 238 AAFDFTTKGILQEAV-KGQLWRLRDSKGKPPGVMGWWPSRAVTFIDNHDTGSTQGHWPFPSHHIMEGYAYILTHPGIPTV 316
297839489 253 AAFDFTTKGILQEAV-KGQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQAHWPFPSHHIMEGYAYILTHPGIPCV 331
168000555 321 FWDHVYDWGTQLRDEILRMIAIRKRNDLHSRSRVEILEANNDVYAAMIDQKVCMKLGDGDWCPRLGD-WELATSGKSYAI 399
15222959  332 FYDHFYDWGSSIHDQIVKLIDIRRRQDIHSRSTVRVLKAESNLYAAIVGEKICMKLGDGSWCPSGRD-WTLATSGHRYAV 410
115458194 363 FYDHFYGKDDSFHGGIAKLMEIRKCQDIHSRSAVKILEASSDLYSAIVDDKLCMKIGDGSWCPSGPE-WKLAASGDRYAV 441
168067856 315 FYDHLYEWSGDLKRVILELIDIRRKLEVHSRSHITILEADTNGYSAVVDNKLCVRLGNTEWTPPSDSlWELTLSGSGYMI 394
225459795 378 FYDHFYDWAGSIHNEIAKLIAVRKEQDIHSRSSIKILEAQPNLYSAIIGDKVCMKIGDGSWCPGGRE-WTLATSGQRYAV 456
242072900 334 FYDHFYDQGVPLHDEIAKLMQIRKCQDIHSRSSIKILEVRSDLYSAIIDDKLCMKIGDGSWCPSDPE-WMLAVSGDRYAV 412
224065715 325 FYDHFYDWGNSIHEQIVKLIDIRKHQDIHSRSSIRIFEAQPNLYSAIIGEKVCMKIGDGSWCPAGKE-WTLATSGHRYAV 403
255539112 317 FYDHFYDWGNSIHEQIVKLIDIRKRQDINSRSSIRILEAQPNLYSAIIGEKVCMKIGDGSWSPSGRE-WTLATSGHRYAV 395
297839489 332 FYDHFYDWGSSIHDQIVKLIDIRRRQDIHSRSTIRVLKAESNLYAAIVGEKLCMKLGDGSWCPSGGD-WTLATSGHRYAV 410
168000555 400 WQK 402
15222959  411 WHK 413
115458194 442 WHK 444
168067856 395 WSK 397
225459795 457 WKK 459
242072900 413 WHK 415
224065715 404 WQK 406
255539112 396 WQK 398
297839489 411 WHK 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap