Conserved Protein Domain Family
PLN02360

?
PLN02360: PLN02360 
probable 6-phosphogluconolactonase
Statistics
?
PSSM-Id: 166001
View PSSM: PLN02360
Aligned: 10 rows
Threshold Bit Score: 521.341
Threshold Setting Gi: 297849772
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242046226   5 SSTTYEPKRNCEIRVFESSDEISTDLAEYISQISEISVKERGYFAIALSGGPLVSFLGKLCEAPYNKTLDWSKWYIFWSD 84 
115453537  22 IVASYEPKKNNEIRMFESSDEMATDLAEYISQVSEISIKERGYFAIALSGGPLISFMRKLCEAPYNKTLDWSKWYIFWAD 101
15222922    1 MALTWTHKDRGEIRVHENLEELSIDLVDYIAEISEASIKEHGAFCIVLSGGSLISFMGKLIEPPYDKIVDWAKWYVFWAD 80 
224112096   1 MAHSRVHKDRGELRIHENLDELGTDLAEYIAELSEASVKERGVFAIAISGGSLIGLMGKLCEAPYHKTVDWAKWYIFWAD 80 
224098998   1 MAHSGVHKDRGELRIHENLDELGTDLAEYIAELSEASVKERGVFAIAISGGSLIGLMGKLCEAPYNKTVDWAKWYIFWAD 80 
242035463   5 IMAPYETKQNCEIRVFESSDEMATDLAEFISQASEISVKERGYFAIALSGGPLVRHMRKLCEAPYNKTLDWSKWYIFWAE 84 
225423434   1 MAHSCVHKDRGELRIYENLNELSTDLADYIAELSEVSVKERGVFAIALSGGSLIDLMGKLYEAPYNKTVDWAKWYIFWAD 80 
225423436   1 MAHSCVHKDRGELRIYENLNELSTDLADYIAELSEVSVKERGVFAIALSGGSLIDLMGKLYEAPYNKTVDWAKWYIFWAD 80 
255541996   1 MALSEVHKDRGELRIHECLDELGTDLADYIAELSEASVKERGVFAIALSGGSLIGLMGKLCEAPYNKTVDWAKWYIFWAD 80 
297849772   1 MALTWTHKDRGEIRVHENLEELSIDLVDYIAEISEASIKEHGAFCIVLSGGSLISFMGKLIEPPYDKIVDWAKWYVFWAD 80 
242046226  85 ERAVAKNHAESNYKLTKEGFIAKVPIPHGHVYSINDNATVEDAATDYEFMIRQLVKVRTIGVSERNDCPKFDLILLAMGA 164
115453537 102 ERAVAKNHVDSYYKSTKEDFLSKVPILNGHVYSINDNVTVEDAATDYEFVIRQLVKIRTVGVSESNDCPKFDLILLSIGS 181
15222922   81 ERVVAKNHDDSNYKLAKDNLLSKVNVFPRHICSINDTVSAEEAATEYEFAIRQMVRSRTVAASDNSDSPRFDLILLGMGS 160
224112096  81 ERVVGKTHADSNYKLAKDGLLSKVPVVPSHVNSINDSVSAEEAADDYEFHIRQLVKTRTINVSDNSDCPKFDLILLGMGP 160
224098998  81 ERVVAKTHADSNYKLAKDGLLSKVPVVPSHVNSINDSVSAEEAADDYEFHVRQLVKTRTINVSDISDCPKFDLILLGMGS 160
242035463  85 ERAVAKNHAESNYKLAKEEFISKVPIPNGHVYSINDNATVEEAATDYEFVIRQLVKVQRVGVSKINDCPKFDLILLNIGP 164
225423434  81 ERVVAKNHSDSNYKLAKDGLLSKVPVVPSHVHSINDTVTAEEAADEYGFAIRQLVKTRVISVSDTSDCPKFDLILLGMGS 160
225423436  81 ERVVAKNHSDSNYKLAKDGLLSKVPVVPSHVHSINDTVTAEEAADEYGFAIRQLVKTRVISVSDTSDCPKFDLILLGMGS 160
255541996  81 ERVVAKNHTDSNYKLAKEGILSKVPIVPSHVHSINDSVSAEEAANEYEFVIRQLVKTRTINVSDISDCPKFDLILLGVGP 160
297849772  81 ERVVAKSHDDSNYKLAKDNLLSKVNVFPRHICSINDTVSVEEAATEYEFAIRQMVRTRTVAASDNSDSPRFDLILLGMGP 160
242046226 165 DGHVASLFPNHPAMELKDDWVTYITDSPQPPPERITFTLPVINSASNIAIVSTGDDKANAVHLAVSDTTEGPDAPtSLPA 244
115453537 182 DGHVASLFPNHPALELKDDWVTYITDSPVPPPERITFTLPVINSASNIAVVATGEDKAKAVYFAISDGTEGPDAP-SIPA 260
15222922  161 DGHVASLFPNHPALEVKDDWVTFLTDSHKPPPERITFTLPVINSAANVVVVATGESKANAIHLAIDDLPLPDSSL-SLPA 239
224112096 161 DGHVASLFPNHPMLDEKSEWVTFITDSPKPPPERITFTLPVINSASNVAVVVTGESKAEAVHLAIDDV--GPDYL-SLPA 237
224098998 161 DGHVASLFPNHPVLDEKDEWVTFITDSPKSPPERITFTLPVINSASNVVVVVTGESKAEAVHLAIDDA--GADCL-SLPA 237
242035463 165 DGHVASLFPDHPALEVKNDWVTYITDSPEPPPERITFTLPVINSASNIAIVATGEDRANAVSFSISDCQEGPDAK-TIPA 243
225423434 161 DGHVASLFPNHSVLEEKDEWVTFITDSPKPPPERITFTLPVINSASNVAVVITGGNKAEAVHLAIDDV--GPDCP-SLPA 237
225423436 161 DGHVASLFPNHSVLEEKDEWVTFITDSPKPPPERITFTLPVINSASNVAVVITGGNKAEAVHLAIDDV--GPDCP-SLPA 237
255541996 161 DGHVASLFPNHSVLDANDEWVTYITDSPKPPPERITFTLPVINSASNVAVIVAGESKAEAVHLAIDDV--GPDCP-TLPA 237
297849772 161 DGHVASLFPNHPALEVKDDWVTFLTDSPKPPPERITFTLPVINSAANVVVVATGESKANAMHLAIDDIPLPESSL-SLPA 239
242046226 245 RMVQPTDGKLVWFLDKEAASSLESMNDDD 273
115453537 261 RMVQPTDGKLVWFLDKASASFLEAKTKND 289
15222922  240 RLVHPSNGNLIWFMDKQAGSKLDRFKFSE 268
224112096 238 RLVQPTKGKLVWFLDKPAASKLDGFQFSE 266
224098998 238 RLVQPTKGKLAWFLDKLAASKLDGSQFSE 266
242035463 244 GMVQPTDGKLVWFLDEAAASSLEA---AN 269
225423434 238 RMVQPTKGKLVWFIDKPAALKLDCCQFSE 266
225423436 238 RMVQPTKGKLVWFIDKPAALKLDCCQFSE 266
255541996 238 RMVHPTKGKLVWFLDKPAASKLDGSQFSE 266
297849772 240 RLVHPSNGNLIWFMDKPAGSKLERFKFSE 268
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap