Conserved Protein Domain Family
PLN02359

?
PLN02359: PLN02359 
ethanolaminephosphotransferase
Statistics
?
PSSM-Id: 166000
View PSSM: PLN02359
Aligned: 15 rows
Threshold Bit Score: 691.133
Threshold Setting Gi: 242095068
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255546949  11 MGYIGTHGVAALHRYKYSGVDHSYVAKYVLQPFWTRFVNFFPLWMPPNM------ITLTGFMFLLTSALLGYIYSPHLDT 84 
30695829    1 MGYIGAHGVAALKKHKYSGVDHSYLAKYVLQPFWNRFVKIFPLWMPPNM------ITLMGFMFLLTSALLGYIYSPKLDS 74 
79313461    1 MGYIGAHGVAALKKHKYSGVDHSYLAKYVLQPFWNRFVKIFPLWMPPNM------ITLMGFMFLLTSALLGYIYSPKLDS 74 
115443849   1 MGYVGQHGVATLRRYKYSGVDHSLVAKYILQPFWSRFVNLFPLWFPPNM------ITLTGFMFLLTSAFLGFFYSPHLDT 74 
168023988   1 MGYVGKHGVEALHRYKYSGIDRSYMAKWVFQPFWRFAVNFFPMWMPPNM------ITLMGFGMVLTSALLSYIYSPNLDA 74 
225425027   1 MRYIGSHGVAALHKYKYSGVDHSYVAKYVLQPFWSRCVNFFPLWMPPNM------ITLMGFMFLVTSALLGYIYSPRLDS 74 
242060238   1 MGYIGHHGVATLRRYKYSGVDHSLVAKYILQPFWSRFVNIFPLWFPPNM------ITLTGFMFLLTSAFLGFLYSPHLDT 74 
224101611   1 MGYIGSHGIAALHKYKYSGVDHSCVAKYVLQPFWARFVNLFPLWMPPNM------ITLMGFMFLVTSAFLGYIYSPRLDT 74 
224111786   1 MGYIGSHGIAALHRYKYSGVDHSYVAKYVLQPFWSRCVNFFPLWMPPNM------ITLMGFMFLVTSALLGYIYSPRLDT 74 
242095068   1 MGFIGAHGVETLKRYRYSGEDRSVVAKYVLQPFWSRCVYLFPLWMPKWLcfptfqITLTGFSFLVLSALLGYIYSPRLDT 80 
255546949  85 APPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFESMAFGSTAMCGRDTFWFWVISAVPFYG 164
30695829   75 PPPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALGCALETMAYGSTAMCGRDTFWFWVISAVPFFG 154
79313461   75 PPPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALGCALETMAYGSTAMCGRDTFWFWVISAVPFFG 154
115443849  75 APPRWVHLAHGMLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFEALAFGSTAMCGKATFWYWFIAAVPFYC 154
168023988  75 PAPRWVYFAHGILLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALTCSFETMAFASSVMSGKLSFWFWVIATIPFYG 154
225425027  75 APPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFETMAFGSTAMCGRTSFWFWVISAVPFYC 154
242060238  75 APPRWVHLAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFESLAFGSTAMCGKATFWFWFISAVPFYF 154
224101611  75 PPPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFESMAFGSTAMCGRDTFWFWLISAVPFYC 154
224111786  75 PPPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFESLAFGSTAMCGRDSFWFWLISAVPFYG 154
242095068  81 APPRWVHLAHGLLLFLYQTFDAVDGKQARRTSSSSPLGELFDHGCDALACAFEALALGSTLMCGGWTFWFWVVAAVPFYL 160
255546949 165 ATWEHFFTNTLILPAVNGPTEGLMLIYVAHFFTALVGAEWWPQHFGKSFPFLNWV--PFISE--IQTYKAVLYLMIAFAV 240
30695829  155 ATWEHYFTNTLTLPVVNGPTEGLALIYCGHFFTAIVGAEWWAQPFGKSIPLFSWV--PFLNE--MQMSRIILFSMIFFAV 230
79313461  155 ATWEHYFTNTLTLPVVNGPTEGLALIYCGHFFTAIVGAEWWAQPFGKSIPLFSWV--PFLNE--MQMSRIILFSMIFFAV 230
115443849 155 ATWEHFFTNTLILPIVNGPTEGLMLIYLCHFFTFFTGAEWWAQDFRKSIPLLNWV--PLVPE--VPVYGIALFLMIAFAV 230
168023988 155 ATWESYFTDTLILPEINGPTEGLMLIYCAHIFTGIVGPTWWTQSVKKVVPGLSMI--SFIPD--VSVTVLVIFLMMAVAV 230
225425027 155 ATWEHFFTNTLILPAINGPTEGLMLIYFCHFFTAIVGAQWWVQEFGKSMPFLSWL--PFVYE--IPTYRVVLFIMIAFGV 230
242060238 155 ATWEHFFTNTLILPIVNGPTEGLMLIYLCHFFTFFTGAKWWAQDFQKSMPLLGWV--PFISE--IPVYDIVLCLMIAFAV 230
224101611 155 ATWENFFTNTLILPAINGPTEGLMLIYMAHFLTAVVGAGWWAQQFAMSFPFLSWL--PFVSE--IPTYRVVQFLMTAFAV 230
224111786 155 ATWEHFFTNTLILPAVNGPTEGLMLIYVAHLFTALVGAEWWVQHFGMSFPFLSWV--PFVSE--IQTYRVVLLLMTAFAV 230
242095068 161 ATWEHFFTNTLILPTINGPTEGLMLIYVSHLFTFLTGAEWWAQDFRKSLPFLGWIplPFLSEikIPLYVLVLILMIVCAV 240
255546949 241 MPTIAFNVSNVYKVVQARKGSMLLALAMLYPFVVLMGGVLVWDYLSASNLMESYPHLVILGTGLAFGFLVGRMILAHLCD 320
30695829  231 IPTLAINTSNVYKVVHSRNGSMLLALAMLYPLVTLIAGVLIWDYLSPIDLIRNYPHLVVLGTGLAFGFLVGRMILAHLCD 310
79313461  231 IPTLAINTSNVYKVVHSRNGSMLLALAMLYPLVTLIAGVLIWDYLSPIDLIRNYPHLVVLGTGLAFGFLVGRMILAHLCD 310
115443849 231 IPTIGSNIHNVYKVVEARKGSMLLALAMLFPFGLLLAGVLVWSYLSPSDIMRNQPHLLVIGTGFAFGFLVGRMILAHLCD 310
168023988 231 TPTVGYNFVNVHKVVRGRGSSFRNALAMLFPFWTLVGSVIFWGWVSPSDIFRFQPHLLMMGTGFAFAYLVGRLILAHLCD 310
225425027 231 IPTVSFNVYNVYKVVQARKGSMLLALAMLYPFAVLMGGVLAWDYLSPSDIMGNYPHLVIVGTGLAFGFLVGRMILAHLCD 310
242060238 231 IPTIASNIHNVYKVVEARKGSMVLALAMLFPFGLLLAGVLVWSYFSPSDIMRNQPHLLIIGTGFAFGFLVGRMILAHLCD 310
224101611 231 IPTVGFNVSNVYKVVQARKGSMLLALAMLYPFVVLVGGVLLWDYLSPSDLMSNYPHLVILGTGLAFGFLVGRMILSHLCD 310
224111786 231 IPTVAFNVSNVYKVVQARKSSMLMALAMLYPFLVLVGGVLVWDYLSPSDLMANYPHLVVLGTGLAFGFLVGRMILSHLCD 310
242095068 241 IPTVRSNVSNVQEVVETRKGSMALALAMILPFITLLAGVAIWSYLSPSSIMRNQPHLLVIGTGFNFGYLVGRMILAHLCD 320
255546949 321 EPKGLKTNMCMSLLYLPFAIANALTARLNDGldgnfaitsflcrVPLVDEFWwdsiytlqhlsfmksrqpwaliasegrf 400
30695829  311 EPKGLKTNMCMSLLYLPFALANALTARLNDG-------------VPLVDEFW---------------------------- 349
79313461  311 EPKGLKTNMCMSLLYLPFALANALTARLNDG-------------VPLVDEFW---------------------------- 349
115443849 311 EPKGLKTGMCMSLAYFPFAIANALTARLDDG-------------NPLVDEQL---------------------------- 349
168023988 311 EPKGLKTGMCTALLYLPFAISNALSATFFEG-------------KPLVDETW---------------------------- 349
225425027 311 EPKGLKTGMCMSLLYLPFAIANALTARLNDG-------------VPLVDESL---------------------------- 349
242060238 311 EPKGLKTGMCMSLAYFPFAIANALTARLDDG-------------NPLVDEQL---------------------------- 349
224101611 311 EPKGLKTNMCMSLLYLPFAIANALAARLNDG-------------VALVDEFW---------------------------- 349
224111786 311 EPKGLKTNMCLSLLYLPFAIANALAARLNDG-------------VALVDEFW---------------------------- 349
242095068 321 EPKGLKSGMFMSLVFLCFPIANALIAKINNG-------------TPLVDELV---------------------------- 359
255546949 401 eVVLSYLDVIRTQIKNNKERSLKNAVIDLASMSGGMKDIDD 441
30695829  350 -VLLGYCIFTLSLYAHFATSVIHEITTALGIYCFRITRKEA 389
79313461  350 -VLLGYCIFTLSLYAHFATSVIHEITTALGIYCFRITRKEA 389
115443849 350 -VLLMYCLFTVALYMHFATSVIHEITNALGIHCFRITRKKA 389
168023988 350 -VLVGYCAFTVCLYGHFVVSVIHEITEALGIHCFR------ 383
225425027 350 -VLLGYCVFTVGLYLHFATSVVHEITSALGIYCFRITRKEA 389
242060238 350 -VLLMYCLFTVALYMHFATSVIHEITNALGIHCFRITTKKA 389
224101611 350 -VLLGYCVFTMGLYLHLATSVIHEITTALGICCFRITRKKA 389
224111786 350 -VLLGYCVFTMLLYLHFTTSVIHEITTALGICCFR------ 383
242095068 360 -LLLLYCAYTVGLYLHLAVSVVHEIKDALGIYCFRITRKEA 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap