Conserved Protein Domain Family
PLN02354

?
PLN02354: PLN02354 
copper ion binding / oxidoreductase
Statistics
?
PSSM-Id: 177987
View PSSM: PLN02354
Aligned: 18 rows
Threshold Bit Score: 1018.95
Threshold Setting Gi: 242090897
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115440681   1 MTTMRASAALLLVAAAVLAaVRAEDPYHFFDWKVTYGTRTIMDVAQKVMLINDMFPGPTINCSSNNNIVVNVFNQLDHPL 80 
15222747    2 KGGVKLLAVCLCVATATVMmVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIVNVFNNLDEPF 81 
242054773   7 RMAMRGASAALLVLALVAAvARAEDPYHFFEWKVTYGTKTIMGTPQKVILINDMLPGPTINCTSNNNIVINVFNMLDQPL 86 
225435844   1 MGGSRVLLALLLCLSAGSFlVRGEDPYFFYTWNVTYGTISPLGVPQQGILINGEFPGPRINCSSNNNIVINVFNNLDEPL 80 
224052845   1 -MAGVMFMVLLCLSAGAMLgVQGEDPYLFFTWNVTYGTLSPLGVPQQVILINDQFPGPNINSTSNNNIVINVFNNIDEPF 79 
224073106   1 -MAGVMFLVLLCISAGTMLgVRGEDPYLFFTWNVTYGTLSPLGVPQQVILINNQFPGPNINSTSNNNIVINVFNNLDEPF 79 
224056915   1 -MAGVMIMVLLCLSAGTMLgVQGEDPYLFFTWNVTYGTRSPLGVPQQVILINDQFPGPNINSTSNNNIVLNVFNNLDEPF 79 
255564774   1 -MEGVMLILLLCLTTGAMLgVHGEDPYLFFTWNITYGTLSPLGVPQQVILINDQFPGPVINSTSNNNVVINVFNNIDEPF 79 
255564776   1 -MAGVMLMLFLCLSAGSLLqVHGEDPYLFFTWNVTYGTLSPLGVPQQVILINNQFPGPVINSTSNNNVVINVFNNIDEPF 79 
297847926   2 KGGVKLLAVCLCVATATVMmVQAEDPYFHHVWNVTYGTASPLGVPQQVILINGQFPGPNINSTSNNNVIVNVFNNLDEPF 81 
115440681  81 LFNWHGIQQRKNSWMDGMPGTNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQRAAGGYGIITVHSRLLIPVPFDEPAGD 160
15222747   82 LITWAGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRAAGGFGGLRVNSRLLIPVPYADPEDD 161
242054773  87 LFTWHGIQQRKNSWQDGMPGTMCPIQPNTNFTYHWQPKDQIGSFVYYPSTGMQRAAGAYGLISVHSRDLIPVPFDRPADD 166
225435844  81 LFTWNGIQQRKNSWQDGLPGTNCPIQPGTNFTYRFQVKDQIGTYFYFPSLGMQRAAGGIGGLRVNSRLLIPVPFDDPEDD 160
224052845  80 LLTWSGIQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAAGGFGGLRINSRLLIPVPYADPEDD 159
224073106  80 LLTWSGIQQRKNSWQDGVLGTNCPILPGTNYTYHFQVKDQIGSYIYYPTTGMHRATGGFGGLRINSRLLIPVPYADPEDD 159
224056915  80 LLTWSGVQQRKNSWQDGVLGTNCPILPGTNFTYHFQVKDQIGSYIYYPTTGMHRAAGGFGGLRINSRLLIPVPYADPEDD 159
255564774  80 LLTWSGIQQRKNSWQEGVPGTNCPIPPGSNYTYHFQVKDQIGSFIYYPSTALHRASGAFGGLHINSRLLIPVPYPDPEDD 159
255564776  80 LLTWSGVQQRKNSWQEGVLGTNCPIPPGTNHTYHFQVKDQIGSFIYYPSTAMHRAAGGFGGLHINSRLLIPVPYPDPEDD 159
297847926  82 LITWNGIQHRKNCWQDGTAGTMCPIPPGQNFTYHFQPKDQIGSYFYYPTTAMHRAAGGFGGLRVNSRLLIPVPYADPEDD 161
115440681 161 YPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEK-DASNPPMYTMEAGKVYRFRVCNVGIKTSLNVRIQGHSLK 239
15222747  162 YTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKtDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMK 241
242054773 167 FPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVINGKNEK-DAANPPMYNVEAGKTYRFRICNVGMKASINIGIQNHIMK 245
225435844 161 YTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKS---EDKDEPLFTMKPGLTYRYRICNVGIKSSLNFRIQGHTMK 237
224052845 160 YTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMgDGKDEPLFTMKPEKTYKYRICNAGLKNTLNFRIQGHTMK 239
224073106 160 YTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKgDGKDEPLFTMKPGKTYKYRICNAGLKNTLNFRIQGHTMK 239
224056915 160 YTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKgDGKDEPLFTMKPGKTYKYRICNAGIKNTLNFRIQGHTMK 239
255564774 160 YTVVLNDWYTKSHKSLRTFLDSGRSLGRPDGVLINGKNAKgDGKDEPLFTMKPDKTYKYRVCNAGIKTSLNFRIQGHEMK 239
255564776 160 YTVIVNDWYTKSHTSLRKSLDSGVSIGRPEGVLINGKTAKgNGKDKPLFTMKPGKTYKYRICNAGLKTSINFRIQGHTMK 239
297847926 162 YTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKtDGSDKPLFTLKPGKTYRVRICNVGLKASLNFRIQNHKMK 241
115440681 240 LVEMEGSHTVQNSYDSLDVHVAQCVSFLVTADQKPGDYLLVASTRFLKEYSAITAIVRYNGSNTPASPKLPEGPSGWAWS 319
15222747  242 LVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQEPKDYYMIASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPVGWAWS 321
242054773 246 LVEMEGSHTMQNDYDSLDIHVGQCLSVLVTADQKPGDYLLVASTRFIKEVSTTTAVIRYKGASAPPPAKLPESPSGWAWS 325
225435844 238 LVELEGSHTVQNVYDSLDVHLGQCYSVLVTANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKGPASPELPEPPSGWIWS 317
224052845 240 LVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKGPASPELPEAPVGWAWS 319
224073106 240 LVEMEGSHVVQNVYESLDVHVGQCFSVLVTANQDPKDYYMVASTRFNKQVLTGKGIIRYTNGKGPASPELPEAPVGWAWS 319
224056915 240 LVEMEGSHVVQNVYEALDVHVGQCFSVLVTANQAPKDYYMVTTTRFNKQILTAKGIIRYTNGKGPASPELPEAPVGWAWS 319
255564774 240 LVEMEGSHVVQNVYESLDVHVGQCLSVLVRANQAPKDYYMVASTRFMKTVQTAKGIIRYTNGKGPASPELPEAPVGWAWS 319
255564776 240 LVEMEGSHVVQNIYESLDVHVGQCFSVLVTANQAPKDYYMVASTRFLKTVLVGKGIVRYTNGKGQASPVLPKAPVGWAWS 319
297847926 242 LVEMEGSHVLQNDYDSLDVHVGQCFGVIVTADQELKDYYMVASTRFLKKPLTTTGLLRYEGGKGPASSQLPAAPVGWAWS 321
115440681 320 INQWRSFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVdDAQTPLKLAEYFNASSGVFEY 399
15222747  322 LNQYRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHT-DPETPLKLAEYFGVADKVFKY 400
242054773 326 INQARSFRWNLTASAARPNPQGSYHYGQINITRTIRLGIGRGKVDGKERFGINGVSHV-DPETPVKLAEYFNATDGVFQY 404
225435844 318 LNQFRSFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHT-DPTTPPKLAEYFGVVDKVFKY 396
224052845 320 LNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHV-DPETPLKIAEYYGVADKLFKY 398
224073106 320 LNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLINSASQEGGKLRYALNGVSHV-NPETPLKLAEYYGVADKVFKY 398
224056915 320 LNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHV-DPETPLKIAEYYGIADKVFKY 398
255564774 320 LNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSPSRAGGKLRYAINGVSHT-DTETPLKLAEYYGIADKVFKY 398
255564776 320 LNQFRSFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASTTGGKLRYAINSVSHV-EPETPLKLAEYFGVANKVFKY 398
297847926 322 LNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHT-DPETPLKLAEYFGVADKVFKY 400
115440681 400 NLIGDVPPA-TT--VPQKLAPNVISAEFRTFIEVVFENPEKSIDSFHINGYAFFAAGMGPGIWTPECRKTYNLLDTVSRH 476
15222747  401 DTISDNPNPdQI--KNIKIEPNVLNITHRTFIEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRH 478
242054773 405 DLIGDVPPA-KS--APTKMAPNVLRAEFRTFIEVVFENPEKSIDTFHIDGYAFFAVGMGPGKWTPACRSTYNLLDTVSRH 481
225435844 397 NTMVDDPPPeSA--EKIVITPNVLNITFRTFVEIIFENHEKSIQSWHLNGYSFFAVAMEPGRWNPDKRKNYNLLDAVSRN 474
224052845 399 DTMQDSPQA-DIahAKIVSQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRT 477
224073106 399 DTILDSPQA-NVanAKIVTQPNVLNLTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAVEPGTWTPEKRKHYNLLDAVSRT 477
224056915 399 NTIKDMPSA-KI--GKVVTQPNVLNQTFRNFVEIIFENHEKSMQSYHLDGYSFFAVAIEPGTWTPEKRKNYNLLDAVSRT 475
255564774 399 DTIKDDPPP-KI--TEVVTQPNVLNMTFRNFVEIIFENPEKSIQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRT 475
255564776 399 DTFQDNPPA-KI--GKIVSQPNVLNMTFRNFVEIIFENPEKSIQSWHLDGYSFFVVAVEPGTWTPEKRKNYNLLDAVSRT 475
297847926 401 DTISDNPNPdQI--KNIKIEPNVLNITHRTFIEVVFENHERSVQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRH 478
115440681 477 TIQVYPRSWTAVMLTFDNAGMWNIRSNMWERYYLGAQLYVSVVSPARSLRDEYNMPEIALRCGKVVGLPMPPSYLP 552
15222747  479 TVQVYPKCWAAILLTFDNCGMWNIRSENAERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG 554
242054773 482 TVQVYPRSWTAVMMTFDNAGMWSIRSNIWERNYLGEQLYISVTSPERSLRDEYNMPETSLRCGKVVGLPLPPSYLS 557
225435844 475 TIQVYPGSWTAILLTFDNAGLWNLRSETWERNYLGQQLYVSVLSPARSLRDEYNIPDVAELCGIVKGLPKPQPYTI 550
224052845 478 TVQVFPKSWAAILLTFDNAGMWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNIPDNTLLCGLVKDLPKPEPYSI 553
224073106 478 TVQVYPKSWAAILLTFDNAGLWNIRSEMWERAYLGQQLYASVLSPARSLRDEYNLPDNSLLCGIVKDMPKPAPYSI 553
224056915 476 TIQVFPKSWAAIFLTFDNAGMWNIRSEMWEKTYLGQQLYVSVLSPELSLRDEYNIPDNALLCGKVKGLPKPKPYTI 551
255564774 476 TVQVFPKSWAAIFLTFDNAGMWNIRSEVWERTYLGQQLYASVISPARSLRDEYNIPDNALLCGLVKDLPKPPPYSV 551
255564776 476 TVQVFPKSWAAILLTFDNAGMWNIRSEMWERTYLGQQLYASVLSPARSLRDEYNIPDNALLCGLVKGLPKPPPYTI 551
297847926 479 TVQVYPKCWAAILLTFDNCGMWNIRSENSERRYLGQQLYASVLSPEKSLRDEYNMPETSLQCGLVKGKPKVNPYAG 554
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap