Conserved Protein Domain Family
PLN02353

?
PLN02353: PLN02353 
probable UDP-glucose 6-dehydrogenase
Statistics
?
PSSM-Id: 177986
View PSSM: PLN02353
Aligned: 48 rows
Threshold Bit Score: 765.375
Threshold Setting Gi: 242047160
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159469518  10 IKRVACIGAGYVGGPAMAILAYKCPDVTVTVLDISDARVQAWNSDQLPIYEPGLTDLVKACRGVNLFYSTDAKKHLAEAD 89 
159491403   1 -MKIACIGAGYVGGPTMAMVALKCPEIEVVVVDINEERIKAWNSEKLPIYEPGLFEVVKECRGRNLFFSTDTKKHVGEAD 79 
145353618   5 ITTICCIGAGYVGGPTMAMIAKKCPQISVTVVDISQPRIDAWNSSELPIYEPGLDEIVFECRGKNLFFSTDVEGAIRDCE 84 
145357284   5 ITTICCIGAGYVGGPTMAMIAKKCPQISVTVVDISQPRIDAWNSSELPIYEPGLDEIVFECRGKNLFFSTDVEGAIRDCE 84 
219113223   6 DLKICCMGAGYVGGPTMAVIAKQCPKIRVCVVDLSQKQIDAWNTDELPIYEPGLLEVVQVCRGKNLFFSTDIDAEIQKAD 85 
224009534   6 DLKICCMGAGYVGGPTMAVIAANCPKVRVCVVDLSQKQIDAWNSPNLPIYEPGLPAVVDQCRNKNLFFSTDIDSEIKKAD 85 
255079378   4 ITTICCIGAGYVGGPTMAMIALKCPHIKVTVVDISQPRIDAWNSDELPIYEPGLDEVVKACRGKNLFFSTDVAGAIRESQ 83 
302828682   1 -MKIACIGAGYVGGPTMAMVALHCPEIEVVVVDINEERIKAWNSDKLPIYEPGLLEVVKECRGRNLFFSTDTKKHVGEAD 79 
302843689   4 IRKIACIGAGYVGGPSMSCLAYKCPDITVTVIDISPERVAAWNSDNLPLYEPGLLEIVKAARGRNLFFSTDAKKHLAEAD 83 
302850907   1 -MKIACIGAGYVGGPTMAMVALKCPEIEVVVVDINEERIKAWNSDKLPIYEPGLFEVVKECRGRNLFFSTDTKKHVGEAD 79 
159469518  90 LIFVCVNTPTKLQGVGAGKAATFGFWEAAARLIAASCQgcGPKIIAEKSPVPVKTAQAMSRVLSGCQDGekTRFEVISNP 169
159491403  80 IVFVSVNTPTKTHGIGAGRAADLTYWEGAARLIASVST--SSKIVVEKSTVPVKTAEAIGKVLKRNCQDpnVNFEILSNP 157
145353618  85 MIFVSVNTPTKKTGLGKGKAADLTYWELAARTIAACSE--SDKIIVEKSTVPVRTAEAIEKVLQRNCPHdgVRFDILSNP 162
145357284  85 MIFVSVNTPTKKTGLGKGKAADLTYWELAARTIAACSE--SDKIIVEKSTVPVRTAEAIEKVLQRNCPHdgVRFDILSNP 162
219113223  86 VVFISVNTPTKTQGIGAGRAANIKNCELCARKIVEVST--TNKIVVEKSTVPVRTAQAITRVLKSNEKG--LEFPVLSNP 161
224009534  86 IIFISVNTPTKTMGIGAGRAANVKNCELCARKIAEVSE--SGKIVVEKSTVPVRTAQAVRRVLDCNEKG--LKFQVLSNP 161
255079378  84 MIFVSVNTPTKKTGLGSGKAADLTYWESAARTIAAESK--DNKIIVEKSTVPVRTAEAIEKVLKRNCSDasVQFDILSNP 161
302828682  80 IVFVSVNTPTKTTGIGAGKAADLTYWEGAARLIASVST--SSKIVVEKSTVPVKTAEAIGKVLKRNCQDpnVQFEILSNP 157
302843689  84 LIFVCVNTPTKLQGVGAGKAATFGFWEAAARLIAASCHgcGPKIVAEKSPVPVKTAQAMSRVLSGCQDGekTQFEVISNP 163
302850907  80 IVFVSVNTPTKTHGIGAGKAADLTYWEGAARLIASVST--SSKIVVEKSTVPVKTAEAIGKVLKRNCQDpnVQFEILSNP 157
159469518 170 EFMSAGSAVEDCLKPDRVLIGGR-DTPEGRAAVESLARLYRRWVPPDRVLSMGLWSSELAKLAANAFLAQRISSINAISA 248
159491403 158 EFLAEGTAMEDLKHPDRVLIGGA-DTESGQKAIRTLAEVYAHWIPRERILTANLWSAELAKLTANAFLAQRISSVNAISA 236
145353618 163 EFLAEGTAIVDLDAPDRVLIGGKiENAKGQAAVDALVGVYSNWVPKENILTANLWSAELSKLAANAFLAQRISSINAMSA 242
145357284 163 EFLAEGTAIVDLDAPDRVLIGGKiENAKGQAAVDALVGVYSNWVPKENILTANLWSAELSKLAANAFLAQRISSINAMSA 242
219113223 162 EFLAEGTAMADLMNPDRVLIGGQ-QNEAGLKAAQTLVSVYANWVPREQILTTNLWSSELSKLVANAFLAQRVSSINSISA 240
224009534 162 EFLAEGTAIPDLMKPDRVLIGGV-QSPEGLAAAETLVSVYANWVPREQIITTNLWSSELSKLVANAFLAQRVSSINSISA 240
255079378 162 EFLAEGTAISDLTAPDRVLIGGKiENEAGQAAVDALAEVYANWVPKNQIITANLWSAELSKLAANAFLAQRISSINAMSA 241
302828682 158 EFLAEGTAIEDLRHPDRVLIGGS-DTESGRKAIESLASVYAHWIPRERILTANLWSAELAKLTANAFLAQRISSINAISA 236
302843689 164 EFMSAGTAIQDCLQPDRVLIGGR-DTPLGQAAVESLARVYRRWVPPERVLSMGLWSSELAKLAANAFLAQRISSINAISA 242
302850907 158 EFLAEGTAMEDLRHPDRVLVGGA-DTESGRKAIETLVSVYAHWIPRERILTANLWSAELAKLTANAFLAQRISSINAISA 236
159469518 249 LCEETGADVQQVSHAIGTDSRIGPRFLSAGCGFGGPALQKHVLNLVYICESLGLAQAAAYWQQasraggqgprVVDMNDW 328
159491403 237 LCEATGADVSQVAHAIGTDSRIGPKFLNASVGFGGSCFQKDILNLCYVCESVGLKEVADYWLQ----------VVSMNDY 306
145353618 243 LCEATGADVQQVSHAIGTDTRIGSKFLNASVGFGGSCFQKDILNLAYICECHGLPEVAEYWHS----------VVGMNDY 312
145357284 243 LCEATGADVQQVSHAIGTDTRIGSKFLNASVGFGGSCFQKDILNLAYICECHGLPEVAEYWHS----------VVGMNDY 312
219113223 241 LCEATGADVLEISRAVGMDARIGNRFLQPSVGFGGSCFQKDILNLVYLCETYGLDECATYWNQ----------VILMNDY 310
224009534 241 LCEATGADVSEITRAVGMDDRIGKRFLNSSIGFGGSCFQKDILNLVYLCETYGLNECAKYWNQ----------VIVMNDY 310
255079378 242 LCEATGADVAQVAHSIGTDSRIGPKFLNASVGFGGSCFQKDILNLAYICECHGLKEVADYWYS----------VVGMNDY 311
302828682 237 LCEATGADVQQVAHAIGTDSRIGPKFLNASVGFGGSCFQKDILNLCYVCESVGLKEVAEYWYQ----------VVSMNDY 306
302843689 243 LCEETGADVQQVSHAIGTDSRIGPRFLMAGCGFGGPALQKHVLNLVYICESLGLSQVAQYWQQ----------VVDMNDW 312
302850907 237 LCEATGADVQQVAHAIGTDSRIGSKFLNASVGFGGSCFQKDILNLCYVCESVGLKEVAEYWYQ----------VVSMNDF 306
159469518 329 IKARFVRRVITSMFNTIRGKRIAVLGFSYKAHTTDTRDTASIDVCRGLLLDGAALSVYDPKVTPEQIHLDMCLPKGSLEQ 408
159491403 307 QKQRFVERVIGAMFNTVSGKKIAVYGFAFKKDTGDTRETPAIDVCKGLIRDGAKCCIFDPEVKAEQIFRDLSAPKFEWDR 386
145353618 313 QKSRFVKRMISAMFNTISGKKISMLGYAFKKDTGDTRESPAIDVGHGLIEDGAKLNIYDPKVAAAQIALDMGE------- 385
145357284 313 QKSRFVKRMISAMFNTISGKKISMLGYAFKKDTGDTRESPAIDVGHGLIEDGAKLNIYDPKVAAAQIALDMGE------- 385
219113223 311 QKKRFSEKIVAKMFNTVTGKKIALMGYAFKKDTGDVRETPSMFVLRDLIQEQAKIFVYDPQVSREDMWSEM-------DY 383
224009534 311 QKKRFSEKMVSHMFNTVTGKKIAVLGYAFKKDTGDVRETPSMFVVRDLVLEQAKIHVYDPQVSREDMFSEM-------DY 383
255079378 312 QKSRFVRRVVSAMFNTIRNKKIAMLGFAFKKDTGDTRETPAIDVGKGLIEDGAQLAIYDPQVKEDQIAYDME-------- 383
302828682 307 QKQRFVERVISAMFNTVSKKKIAIFGFAFKKDTGDTRETPAVDVCKGLIRDGAKVCVYDPEVTAEQIFRDLSAPKFEWDR 386
302843689 313 TKARFVQRIITSMFNTIRGKRIAVLGFSYKADTTDTRDTAAIDVCRGLLLDGAALAVYDPKVSPEQIHLDMCLPRGSLEQ 392
302850907 307 QKQRFVERVISAMFNTVSQKKIAIYGFAFKKDTGDTRETPAIDVCKGLIRDGAKVCVYDPEVTPEQIFRDLSAPKFEWDR 386
159469518 409 PRRQHTA---VSLATVDVARSAMEACRGAHGVCVLTDWPEFRRLDFHAIFKAMMKPAFIFDGRNVLDHARLREIGFVVYA 485
159491403 387 PNYSRSQs--HMLENVQVQSDPIAAADGAHAICVLTEWDEFKHYDYAALYEKMVKPAFIFDGRNILDHAKLREIGFIVYA 464
145353618 386 ----------EAMKSITCCKTHTESLTGAHAVCIMTEWDEFKTYDWEAIYGVMQKPAFVFDGRLILDHQKLKDIGFIVYA 455
145357284 386 ----------EAMKSITCCKTHTESLTGAHAVCIMTEWDEFKTYDWEAIYGVMQKPAFVFDGRLILDHQKLKDIGFIVYA 455
219113223 384 TCGVNHQntpGLDDAVVTATDPYQACDGAHAMAILTEWDEFKTLDFDRIYKSMAKPAFLFDGRNLLDHEKLRDMGFEVHA 463
224009534 384 TVQMSESthpGLEAAVTTSPDAYAACDGAHAFAVLTEWDEFKDLDFERIYKSMAKPAFVFDGRNILDHEKLRGMGFEVHA 463
255079378 384 ----------GMMGNITCYKTAKEALQDAHAVTIMTEWDEFKSYDWKEIYDVMQKPAFVFDGRLILDHDHLREIGFIVYA 453
302828682 387 PNYSRSAs--HMLENVQVVQDADAAAEGAHAICVLTEWDAFKTYDYQAMYDKMTKPAFIFDGRNILDHAKLREIGFIVYA 464
302843689 393 PRRQHTT---VSLATVDVARSAYDACRGAHGLCFLTDWPEFRSLDFRAIYAAMMKPAFVFDGRNLLDHGALREIGFVVYG 469
302850907 387 PNYSRSHs--HMLENVQVVSDSAAAAEGAHAICILTEWDEFKSYNYQALYDKMTKPAFIFDGRNILDHAKLREIGFIVYA 464
159469518 486 LGKPLDPFL 494
159491403 465 LGKPLDPFL 473
145353618 456 LGKPLDPFL 464
145357284 456 LGKPLDPFL 464
219113223 464 IGKPDPTAF 472
224009534 464 IGKPDPNKF 472
255079378 454 LGKPIDPFI 462
302828682 465 LGKPLDAFL 473
302843689 470 AGMSWKNGS 478
302850907 465 LGKPLDPFL 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap