Conserved Protein Domain Family
PLN02345

?
PLN02345: PLN02345 
endoglucanase
Statistics
?
PSSM-Id: 177979
View PSSM: PLN02345
Aligned: 19 rows
Threshold Bit Score: 797.801
Threshold Setting Gi: 168059310
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168021492   1 MLIISLNFSQQCAAGKLpEKFPIPWRGDSNLVDGKDMGVDLSGGLYDAGDSVKFGLPMAFTATLLSWGVLEYGPVMGKAG 80 
115480355  61 ALGVALQFFQVQKAGKL-ENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPMAFTATVLSWSILEYGDQMSATK 139
115469968  53 ALAVALQFFQVQKSGKL-VNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGFPMAFTATMLSWSVLEYGDAMRAAD 131
224134118  62 ALEIALQFFDGQKSGKL-VNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFGFPMAFTATMLSWAILEYEENMKTAK 140
242049970  58 ALGVALQFFQVQKAGKL-ENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTATVLSWSVLEYGDQMSAAK 136
242097074  56 ALAVALRFFQVQKSGKL-VNNTIPWRGDSALRDGEDAKLDLSKGMYDAGDHMKFGFTLAFTGTMLSWSVLEYGDAMRAAH 134
302756245  94 PLKISLQFFDIQKSGKLpPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGDYIKFGFPMAFTATILSWSILEYRKEYTATQ 173
302766549   1 -----MRFLDAQKSGKLpKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGDNVKFGFPMAFTATILAWSILEYRSGYNASG 75 
302775704  94 PLKISLQFFDIQKSGKLpPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGDYIKFGFPMAFTATILSWSILEYRKEYTATQ 173
302792561  75 PLELAMRFLDAQKSGKLpKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGDNVKFGFPMAFTATILAWSILEYRSGYNASG 154
168021492  81 QLNSAKNSIRWVTDYLLKAHTSPQELYFQVGDPTKDHKCWMRPEDGNLVRPSLKLDPTTPGSEVAAETAAAMAAASMVFR 160
115480355 140 QLDPALDALRWITDFLVNAHPSDNVFYIQVGDPDLDHNCWERPETMSEKRPLTQINTKSPGSDVAAEAAAAMASASIVFK 219
115469968 132 QRDSAIDALNWIMDYLVNAHPSDDVLYIQVGDPKADHKCWERPEKMKEKRPLTKITPKSPGSDVAAETAAAMAAASLVYK 211
224134118 141 QLGHARDSLKWITDFLINAHPSENVLYIQVGDPELDHQCWERPEAIRGIRPLTQVNTSFPGTEVAAETAAAMASASLVFK 220
242049970 137 QLDPALDALKWITDFLIAAHPSDNVLYIQVGDPDLDHNCWERPETMTEKRPLTQINKKSPGSDVAAEAAAAMAAASMVFK 216
242097074 135 QRDAAMDALGWIMEFLVNAHPSDDVLYIQVGDPKSDHKCWERPETMSEKRPLTKITAKSPGSDVAAETAAAMAAASMVYK 214
302756245 174 QLHSVTGSLKWITDYLIKAHASENELYFQVGSPRLDHACWERAEKMDTARPSFKLDPSHPGTEVAAETSAAMAAASLVFR 253
302766549  76 QLQSALESLQWLTDYFVAAHPSKNELFFQVGSPSSDHVCWEKPETMDTPRPCLSVNTSKPGSDVAAETSAAMAASSLVFR 155
302775704 174 QLHSVTGSLKWITDYLIKAHASENELYFQVGSPRLDHACWERAEKMDTARPSFKLDPSHPGTEVAAETSAAMAAASLVFR 253
302792561 155 QLQSALESLQWLTDYFVAAHPSKNELFFQVGSPSSDHVCWEKPETMDTPRPCLSVNTSKPGSDVAAETSAAMAASSLVFR 234
168021492 161 ATDVAYADLLVTHAKQLFNFSDTYRASYSLSIPAVQDFYNSTGYGDELLWGATWLYYATGDNIYLAYV-TGVDGESFAEW 239
115480355 220 SRDTTYSDSLLQHAQKLFTFADTYKGLASDTYPKLQNYYNSTGYQDELLWAASWLYHATGDQTYLSYV-TVENGKAFADW 298
115469968 212 TINKTYSSSLLDHGERLFAFADKHRGSYTRTFPELSAFYNSTTYQDELLWAASWLYHATGNHSYLAYA--TGKNKDFADL 289
224134118 221 KIDSSYSNLLLEHAQQLFSFADAYRGSYSVSIPQVQNYYNSTGYEDELLWAAAWLYHASKDLSYLKYV-TELNGQQFANW 299
242049970 217 SRDTTYSDVLLQHAQKLFTFADTYRGLSSESYPKLQDFYNSTSYVDELLWAASWLYHATGDQTYLSYV-TVQNGKTYADW 295
242097074 215 PANATYASSLLDHAERLFAFADKHRGSYTRTFPELSAYYNSTTYQDELLWAASWLYHATGNHSYLSYA-TGKNADQFADL 293
302756245 254 NDDPSYAQTLLSHATQLFAFADKHRGSYTASFPSDQLYYNSTGFEDELLWAASWMFYATKDSKYLAYA-TGKLAQLSAGW 332
302766549 156 SDNSSYADELLGHAKDLFSFADGFRGSYTRSFVKDQQFYNSTGYGDELLWAAAWLYHATGEEEFLEYAtTGKEASPNAGW 235
302775704 254 NDDPSYAQTLLSHATQLFAFADKHRGSYTASFPSDQLYYNSTGFEDELLWAASWMFYATKDSKYLAYA-TGKLAQLSAGW 332
302792561 235 SDNSSYADELLGHAKDLFSFADGFRGSYTRSFVKDQQFYNSTGYGDELLWAAAWLYHATGEEEFLEYAtTGKEASPNAGW 314
168021492 240 GVfPSWFSWDNKRPGVQ--------VLLARL--QMLNpPSNAVNTVSIGLTNYKTTADGLMCAFLPRSPTASKDRTKGGM 309
115480355 299 GR-PTWFSWDDKLAGTQ--------VLLSRL--NFFG-SKQTSNAENMGLKMYRDTAEAVICGLLPDSPSATASRTGGGL 366
115469968 290 GN-PRYFSWDDKRAGTE--------VLLSRV--SFFA-SQGSDVAQDDVLGMYKQTADAVMCILLPDSETAAF-RTEGGL 356
224134118 300 GN-PTWFSWDDKHAGTH--------VLLSRL--NIFG-AKGMSSEENLDLQMYRKTSEAIMCELLPDSPTATSSRTKGGL 367
242049970 296 GR-PTWFSWDDKNPGTQ--------VLLSRL--NFFG-SKQISNAENEGLKSYRDTAEAVICGLIPDSPQATASRTGGGL 363
242097074 294 GN-PRYFSWDDKRAGTE--------VLLSRV--RFFA-ADGSDAGQDEVLGSYKDTAEAVMCILLPESDTAAF-RTEGGL 360
302756245 333 EKaPAWFSWDDKKPGIQasslklssVFLTSI--SFLV-----------SLVKYGKTAEHLVCAFLPQSPTASTNRSTGGL 399
302766549 236 GKaPAWFSWDDKVAGLQ--------VLLARK--HIFQ-PQEANTKVGAALDKYKSTADELVCALLPDSPTTSTNRTRAGM 304
302775704 333 EKaPAWFSWDDKKPGIQ--------ASFSTLsqTFYD------VMVRSSLVKYGKTAEHLVCAFLPQSPTASTNRSTGGL 398
302792561 315 GKaPAWFSWDDKVAGLQ--------VLLARK--HIFQ-PQEANTKVGAALDKYKSTADELVCALLPDSPTTSTNRTRAGM 383
168021492 310 LWIEQWSALQHGINSALLATFYSDYLSAAQLPGISCSGISFTPAELRSFAASQADYVLGANPLSTSFMVGYGAEYPQKLH 389
115480355 367 VWISGWNSLQHATNAAFLAVVYSDYMLTSQTAAVQCSGKYYSPTDIRNFAISQANYILGDNPMKLSYLVGYGSSYPQQVH 446
115469968 357 LYVAEWNSLQHPVASAFLAAVYSDYMQSSGKTELSCSGQGFSPADLRKFAKSQADYLLGSNPMKISYLVGYGDRYPEKVH 436
224134118 368 VWVSKWNCLQHAMASAFLAVLFGDYMVTTQISTLYCQGKSYSPADLRNFAISQADYILGNNPMKMSYLVGYGSNYPQNVH 447
242049970 364 VWISGWNSLQHATNAAFLAVVYSDYMLSTRTAAVQCSGKYYSPTDIRNFAASQANYILGDNPMKLSYLVGYGSSYPQQVH 443
242097074 361 LYVAEWDSLQHPVASAFLANVYSNYMATSGKSELTCSGKSFTALDLRKFAKSQADYVLGDNPMKLSYLVGFGDTYPQRVH 440
302756245 400 LWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQFRCSGNSFAAKDLRAFAASQADYILGENPMSKSYLVGYGANFPQQLH 479
302766549 305 IWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGKIFQVEHLRELAGFQADYILGKNPMGMSYVVGYGKKYPLRLH 384
302775704 399 LWVSQRNAVQHAVGSAFLAVVYADYLSSSGVKQFRCSGNSFAAKDLRAFAASQADYILGENPMSKSYLVGYGANFPQQLH 478
302792561 384 IWVSQWNSIQHAVNSAFLSCLYADYLSSAGITTLSCSGKIFEVEHLRELAGFQADYILGKNPMGMSYVVGYGKKYPLRLH 463
168021492 390 HRGASIPVNpTVYDCkGGFIWFDSTQPNPNIAHGAIVGGPFKNETYSDTRDNILQNEASTHNSAAMASLTAGLSVSGNYP 469
115480355 447 HRGASIPAD-AKTGC-KGFQYLHSTSPNPNVAMGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGLVTTSSVA 524
115469968 437 HRGASIPED-VDTGC-DGHKWLETSKPNPNVATGALVGGPYKNDSFVDERDNVMQNEATTYNSALVAGLLSALVSTSSLA 514
224134118 448 HRGASIPVD-ANTTCkDGFTWLDSINPNPNVAVGAVVGGPFLNETYIDSRNNWMQAEPTTYNSALVVSLLSSLVRSSSVV 526
242049970 444 HRGASIPAD-AKTGC-KGFQYLHSSDPNPNVAVGALVGGPFQNDTFVDSRDNAVQTESSTYNSGTLVGLLSGLVTTSSVV 521
242097074 441 HRGASIPAD-VDTGC-DGQKWLKSPDPNPNVATGALVGGPFKNDSFVDDRENVQQNEPTTYNSALVVGLLSSLLSTAPVA 518
302756245 480 HREASIPLD-AATGCkDGFRWLHASAPNPHVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVALYANGPIL 558
302766549 385 HRAASIPSTlSEVECkEGFQYLHTSTPNPNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASLFAAAPKL 464
302775704 479 HREASIPLD-AATGCkDGFRWLHASAPNPHVATGALVGGPFQNDSYSDLRDNTMQNEATTYNSAAMSALLVALYANGPIL 557
302792561 464 HRAASIPSTlSEVECkEGFQYLHTSTPNPNIAEGALVGGPFQNDSFVDDRDNSMQNEATSYNSAGLAALMASLFAAAPKL 543
168021492 470 IPLS 473
115480355 525 QSFT 528
115469968 515 RSLS 518
224134118 527 DSFT 530
242049970 522 QSFT 525
242097074 519 KSLS 522
302756245 559 PTAL 562
302766549 465 PSQL 468
302775704 558 PTAL 561
302792561 544 PSQL 547
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap