Conserved Protein Domain Family
PLN02344

?
PLN02344: PLN02344 
chorismate mutase
Statistics
?
PSSM-Id: 177978
View PSSM: PLN02344
Aligned: 35 rows
Threshold Bit Score: 386.272
Threshold Setting Gi: 242064234
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224141445  39 LRVSCPNLTKRRILSVQASAVSMGLTEKKRVDISENLTLDNIRSSLILQEDSIIFSLLERSQYCYNASTYDPEAFALEGF 118
159478747  15 WASYGHHTARRCRATLVPKAAAVQPASANTRDMSSALSLANIRSSLIRQEDTIIFSFIERAQFCRNLPVYTPDAIPVPGF 94 
145349512  38 RRRRALGRDARATAARDRVNGGGVNESVDYEDLSDRLKLDNVRQSLIRQEDSIIFALIERAQYKLNSAIYAKNAVPVPCF 117
219114109   1 ----------------------MSATDCHNIKTVDVLSLDSIRSSLIRQEETIIFALIERAQFRQNEIVYRKGGFGNLGT 58 
219111571   1 ----------------------MSATDCDNIKTVDVLSLDSIRSSLIRQEETIIFALIERAQFRQNEIVYRKGGFGNLGT 58 
115476628   1 -------MAAAMILSCRYLLICSATLALLLLRLCSGLSLDTVREFLTREEDTVVFGLIERAKHPRNTPAYDPGYLAGGGH 73 
242064234   1 ----------------------------MDAAGGEQLSLAAVRDALVRLEDSVVFALIERARHPRNAPAYAPAAGGGGGY 52 
242079307   1 ----MAVRAIHTPPLLLCTVALLLLTGGLVSPSTAELSLDTVRDFLTREEDTIVFSLIERTKYPLNRPAYEPLHFGDGAA 76 
255081634  46 SFPEQRARRSGTACSAATASSSKAGSNGTQTDKSDRLSLDNIRASLIRQEDSIIFGLIERAQYSINAAVYQPGGVDVPCF 125
302837317   1 -------------------------------DMSSALSLANIRSSLIRQEDTIIFSFIERAQFARNLPVYTPDAIPVPGF 49 
224141445 119 HG----------SLIEFILKETEKLHAQLGRYKSPDEHPFFPDDLP---EPVLPPLQYPQVLHPI---TDSININKTVWD 182
159478747  95 DRcgr-----rySLLEYVLRQTEQLHGSVRRYTSPDEHAFFPDDLP---TLVLPPITYPSVLDPC---ADAININDQILR 163
145349512 118 APngd-----raSMLEFMLREVEQSHGKIRRYTSPDEHAFYPEAQP---PLVIPPIAFKDVLHPC---AESININDRIME 186
219114109  59 PVgstsvedhdlSFMEYMLVGTEALHCGVRRYTSPEEHAFFPERLPygqMDALPLLEYPQELLSSvggACDLNFNKALLQ 138
219111571  59 PVgstsvddhdlSFMEYMLVGTEALHCGVRRYTSPEEQAFFPERLPygqMDALPLLEYPQELLSSvggACDLNFNKALLQ 138
115476628  74 GHd--------aSFAEMFVRESEAVQAKAGRYQSLQEIPFFPFRVP---FTLAPPYNFTTELYSA---AALVNVNDAIWS 139
242064234  53 ------------SLVEFFVREAEALNAKAGHYQKPEDVPFFPQDLP---SPLFPTKPSPKALHPF---ALLVTVNDAIWK 114
242079307  77 HRln-------aSFAELFIRESEAVQSKAGRYQSLQEIPFFAYRVP---FTLAPPYNFTRDLYPA---AALLNVNDAIWS 143
255081634 126 HPdgt-----raSMLEFMLRENEQTGGKIRRYTSPDEHAFYPDSLP---LLVIPAMSYPNPLAPA---AEGININARIMD 194
302837317  50 DRcgr-----rySLLEYVLRETEQLHGSVRRYTSPDEHAFFPDELP---PLVLPPITYPSVLHSC---ADVININDRILR 118
224141445 183 MYFRELIPRLVKEGDDGNCGSTAVCDTICLQALSKRIHYGEFVAEAKFRASPDDYEAAIRAQDSKRLMEILTYPAVEEAV 262
159478747 164 VYVDDILPGLTTPGDDFNYGSSATLDVPCLQALSKRIHYGKFVAEAKFLAKPEEYSALIRAGDADGIMALLTDKEVERRV 243
145349512 187 MYVDNLLPEMCEGGDDNNYGSASLCDLSCLQTISRRIHYGKYVAESKFLAQPEEYTELIKAQDADGLMALLTNQAVEDRV 266
219114109 139 NYVEKIVPSVSKQGDDEQHGSTVLCDIAALQALSRRIHYGKFVAESKYRSDPSGYQQLVDANDADGVMKLLTNRVVEEKV 218
219111571 139 NYVEKIVPSVSQQGDDEQHGSTVLCDIAALQALSRRIHYGKFVAESKFRSDPSGYQQLVDANDADGVMKLLTNTVVEEKV 218
115476628 140 MYFNELLPLLAKNGDDGNYAATVSSDLVCLQALSRRINYGRYVAEVKFIGDQQNYTTLIRNKDTDALMKLLTSEAQEDVV 219
242064234 115 MYFDELLPLFTVDGDDGNYAQTVALDFACLQVLSQRIHIGKYVAEVKFKDAPQDYSRLIKAKDSNSLMDLLTFKAVEEKV 194
242079307 144 MYFNELLPLLAKNGDDGNYAVTVDADLACLQVLSRRINYGRYVAEVKFRGDQQTYTSLIQAKDRDALMKLLTSEAQEDVV 223
255081634 195 MYVNDLLPALCQEGDDFNYGSTGLADVSNLQCLSKRIHYGKFVAESKFQAKPEEFTELIKAQDAAGLMDLLTYKEVEDRV 274
302837317 119 IYVDDILPGLTAPGDDFNYGSSATLDVTCLQALSKRIHFGKFVAEAKFLSKPEEYGALIRAGDADGIMELLTDRRVERRV 198
224141445 263 KKRVEMKAKAFGQEVTMEGEIDG------------TDPVYKIRPTLVADLYGEWIMPLTKEVQVQYLLRsclmnegimqr 330
159478747 244 VERVRRKVATFGQDVTENGTAAAsga------ngdGAPRLKVSPDLVARVYEEIVMPLTKEVEVIYLLR----------- 306
145349512 267 VRRVANKAAVYGSDISEDIPDTLal--------pvGSESLKLAPEKVGELYYRWIMPMTKDVQVKYLLR----------- 327
219114109 219 IRRAKLKAATYGTEPLLSEMPPI------------KGADTTSIVAAAAAVYRDIVIPLTKVIEVAYLFR----------- 275
219111571 219 IRRAKLKAATYGTEPLLSEMPPIkgadtt-sivaaAAAPGKIDPTVIESVYRDIVIPLTKVIEVAYLFR----------- 286
115476628 220 KRRVQKKAMVFGQNVTLDGPVETgns-------nsSQTSFKVDPSLVYKLYDKWVIPLTKQVEVEYLLH----------- 281
242064234 195 KKRVEKKARTFGQNVTLEDNATA------------SDSECKVNPKVLSKLYDQWVMPLTKDVEVEYLLR----------- 251
242079307 224 KRRVEKKAVVFGQTITLDGPIQTdvn-------hsSQANFKVDPSVVYKLYDQWVIPLTKQVEVEYLLH----------- 285
255081634 275 VRRVTNKAATYGQDISEELPSDLglr-------nqKDIEYKVAPERVGELYREWIMPMTKDVQVEYLLR----------- 336
302837317 199 VERVRRKAATFGLDITENGALPPaggsnggggdaeAGPRLKVSPELVARVYEDIVMPLTKDVEVMYLLR----------- 267
224141445 331 rksattfatyletcieepghcikceasftilvvscaqklhmKLE 374
159478747 307 -----------------------------------------RLD 309
145349512 328 -----------------------------------------RLD 330
219114109 276 -----------------------------------------RCG 278
219111571 287 -----------------------------------------RCG 289
115476628 282 -----------------------------------------RLD 284
242064234 252 -----------------------------------------RLD 254
242079307 286 -----------------------------------------RLD 288
255081634 337 -----------------------------------------RLD 339
302837317 268 -----------------------------------------RLD 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap