Conserved Protein Domain Family
PLN02343

?
PLN02343: PLN02343 
allene oxide cyclase
Statistics
?
PSSM-Id: 177977
View PSSM: PLN02343
Aligned: 23 rows
Threshold Bit Score: 302.859
Threshold Setting Gi: 168015537
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168037497   1 MGRAGGAGLrapclpsRRSRGGAGCELAASAPRERRNPVQSSIRSVLDVEPRVFA----DGEPHSCQTFTVYELNEFDRD 76 
168063734   1 -------------------------------------------------------maarGASPGHVQELFVYEINERDRG 25 
168054698   1 ----------------------------------------------------------mTHFAVTEQTFTVYELNEFDRD 22 
167997095   1 -------------------------------------------------------mgnkVDKLAGVQELSVYEINERDRG 25 
224079844  25 PTKPSLLSF---------------KLAQNPCLLTKSTSLGNFSGTKRSFSCKSQAasteDSRPTKVQELSVYEINERDRG 89 
225451968  26 TPAHRLLPFkfsnpspSHNLTLHSTHYSFPKPARSISFSCKAQSSPSD-----------PPRPTKVQELHVYEINERDRG 94 
242035385  37 VSGPSSAAGaglakarRQQAPRVAIRGAAGAGQQPRSRRGAAAAVVRASLFSPKPaaakDARPTKVQELYVYEINERDRE 116
255579071  26 AASRSNAPTksllpfkIANPSSPFTHNPRLLLSKSAAFNNFNLPKRSFSCKNQAApsddNSRPTEVQELCVYEINERDRG 105
302810139   1 -----------------------------------------------------------AQQPREVQTLSVYEINELDRG 21 
302772216   1 -----------------------------------------------------------AQQPREVQTLSVYEINELDRG 21 
168037497  77 SPAFLELSRQSVNrtdpvtgehvKALGDQVPFTNKLYDSSLRTRLGITTGICLHMKQYPGRGApelhglpfftpDHYETI 156
168063734  26 SPVFLPFGGKKQPgtd----ahvNSLGDLVPFSNKIYDGSLKTRLGITAGLCTLISHSDQKNG-----------DRYEAL 90 
168054698  23 SPAFLELSRQTVNrvdpntgdhiKALGDQVPFTNKLYNSALEMRLGITTGICLHMKNYPGRGApelhslpfftsDHYETI 102
167997095  26 SPVILPFGGKKDEnga-----haNSLGDLVPFSNKVYDGSLQRRLGITAGICTLISHNAEKKG-----------DRYEAQ 89 
224079844  90 SPAYLRLSQKSV-----------NSLGDLVPFSNKLYTGDLQKRVGITAGLCVLIQNKPEKKG-----------DRYEAI 147
225451968  95 SPAYLRLSQKSV-----------NSLGDLVPFSNKIYTGDLEKRLGVTAGLCVLIQNVPGKKG-----------DRYEAT 152
242035385 117 SPAYLRLSAKQSE----------NALGDLVPFTNKVYSGSLDKRLGITAGICVLIQHVPDRNG-----------DRYEAI 175
255579071 106 SPAYLRLSQKQV-----------NSLGDLVPFSNKLYTGDLQQRIGITAGICILIQNKPEMKG-----------DRYEAI 163
302810139  22 SPVLLKGDKAKPT----------NALGDLVPFSNKLYDGCLETRLGITAGLCVLIKHVPGKG------------DRYEAT 79 
302772216  22 SPVLLKGDKAKPT----------NALGDLVPFSNKLYDGCLETRLGITAGLCVLIKHVPGKG------------DRYEAT 79 
168037497 157 MSWHLGDMGHISGMGPFINFQDTLMGVTGGTGFFAEARGVVRLHPIT-PFKFMYTFTLTGIP-KLPEVLTKELVVPGFGV 234
168063734  91 YSFYFGDYGHISVQGPYITYEDSYLAITGGSGIFAGCYGQAKLHQIIfPFKLFYTFYLQGIK-KLPEALCAPCVPPSPSV 169
168054698 103 MSWYFGDMGHISGMGPFINFQDTLMGITGGTGFFAEARGVVRLHPIT-PFKFMYTFTLSGIP-ELPGFLTKELAPPHFEV 180
167997095  90 YSFYFGDYGHISVQGPYITYEDTELVVTGGTGIFAGCHGVAKLHQIIfPVKLFYTFYLQGIK-KLPEELCASVVPPSPSA 168
224079844 148 YSFYFGDYGHIAVQGSYLTYEDTYLAVTGGSGIFEGVYGQVKLQQLVfPFKLFYTFYLKGLKaDLPEELLGKAVEPSPAV 227
225451968 153 YSFYFGDYGHISVQGAYLTYEDTYLAITGGSGIFEGAYGQVKLQQIVfPFKLFYTFYLKGIK-ELPADLLGKPVSPSPNV 231
242035385 176 YSFYFGDYGHISVQGPYLTYEESYLAVTGGSGVFEGAYGQVKLNQIVfPFKIFYTFYLKGIP-DLPRDLLCTPVPPSPTV 254
255579071 164 YSFYFGDYGHLAVQGPYLTFEDTYLAVTGGSGIFEGAYGQVKLQQIVfPFKLFYTFYLKGLKtDLPDELLRKPTEPHPAV 243
302810139  80 YSFYFGDYGHISVQGAYITYQDTYMAITGGSGIFNGARGQVKLQQIIfPTKLFYTFYLEGIA-KLPAQLTKPHVAPAKHV 158
302772216  80 YSFYFGDYGHISVQGAYITYQDTYMAITGGSGIFNGARGQVKLQQIIfPTKLFYTFYLEGIA-KLPAQLTKPHVAPAKHV 158
168037497 235 EAHADAVQGKPESTLANFTN 254
168063734 170 APADEAKQCLPNHVAPNFTK 189
168054698 181 ESHPDALKCKSESVLPNYTD 200
167997095 169 EPSEQAKKCHPSSVAPNFTN 188
224079844 228 EPSPAAKACEPHAVIANY-- 245
225451968 232 EPAPSAKACEPHACIANFTD 251
242035385 255 EPTPAAKAAEPHASINNYTN 274
255579071 244 EPHPDAKACQPHATVANFTD 263
302810139 159 EPSPSAR--QGQSVAPNFTD 176
302772216 159 EPSPSAR--QGQSVAPNFTD 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap