Conserved Protein Domain Family
PLN02342

?
PLN02342: PLN02342 
ornithine carbamoyltransferase
Statistics
?
PSSM-Id: 177976
View PSSM: PLN02342
Aligned: 17 rows
Threshold Bit Score: 562.489
Threshold Setting Gi: 223993805
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223993805   1 MFASLRFANQPSIRLAADIFVKNGCAKRAMSISAL-------SGLEG-KHFISIDKLSNEELRGLLDLSKKYRDTYGKNS 72 
159465437  11 PCSTSSRSCSHVPVRRPATSRRALHIVAAQSTQPYwysaktiTPPKKgKHFLHLDDFSRDELLDMLEKAKLCKAKFYTRD 90 
145340646   1 --------------------------------------mpvgKPVPCeKHFLHLDDFTKEEIMELVERASSEKKRLQSGD 42 
168048963   1 MTAEPHPCPSPRGKYVGALGIRPYSFSSSSQRAILks---rdCKTKKpIHFLHLDDFDKETLVHILDRAAEVKAKLKSGD 77 
168045637   1 --------------------------------------------MKGpTHFLHLDDFDKDTLLHILDRAVEVKARLKSGD 36 
242066266  25 LPPSPRTARPIAANAASPVARRGVAAAAVSSPAVSaaa--gkDAKQApKDFLHINDFDKDTIMNILNRAIEVKAAIKSGD 102
255070493  16 AGVGGFVTRRTDSVRQASSTVRGKVLTYCKVSTLR-------ESLSKpPSFLHIDDNDEAKIDALLERASEIKHIISSND 88 
302810596   5 QSVDHLRAGSTSAGGKSCARRRLSVVCSSSSPTVAprvsspiGGRSKpLHFLHVDDFDKKEILHLLERAVEVKALLKSGD 84 
302814549  13 QSVDHLRAGSTSVGGKSCARRRLSVVCSSSSPTVAprvsspiGGRSKpLHFLHIDDFDKKEILHLLERAVEVKALLKSGD 92 
302833595  14 ASTSSRVPRSSIARPSPCRRQRALHVVAAQSTQPYwysaktiAPPKRgKHFLHLDDFTREELLDMLEKAKLCKAKFYTRD 93 
223993805  73 aadpaTAPKPLTGQSVSMIFQKRSTRTRVSTETGMNLLGGQSLFLGPSDIQLGVNESMRDTALVLSRFNSLILARVFSHN 152
159465437  91 -----ESFKPFAGQTMAMIFTKPSARTRVSFETGFFRLGGHALYLDPNTIQLGKREPTKDIARVLSGYNDVIMARLFAHA 165
145340646  43 -----RSFQPFKGKTMAMIFAKQSLRTRVSFETGFKLLGGSAIYLGPDDISIGKREATKDIARVISRYNDIVMARLYEHS 117
168048963  78 -----RSYQPLKGMSMSMIFTKPSMRTRVSFETGFYQLGGHAIYLGPDDIQLGKREETRDIARVLSGYNDVIMARLFAHK 152
168045637  37 -----KSYQPLKGMSMAMIFTKPSMRTRVSFETGFYQLGGHAIYLGPNDIQLGKREETRDIARVLSGYNDVIMARLFGHK 111
242066266 103 -----RSFQPFKGKSMAMIFAKPSMRTRVSFETGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSGYNDIIMARVFAHQ 177
255070493  89 -----LAYQPFKGRTLCMIFTKPSLRTRVSFETGFHLLGGHAIYLGPEDIGLGGREDTKDIARVLSRYNDIIMARTFAHQ 163
302810596  85 -----RSFRPFNGKSMAMIFTKPSMRTRVSFETGFFLLGGHAIYLGPDDIQIGKREETRDVARVLSGYNDVIMARLFAHQ 159
302814549  93 -----RSFRPFNGKSMAMIFTKPSMRTRVSFETGFFLLGGHAIYLGPSDIQIGKREETRDVARVLSGYNDVIMARLFAHQ 167
302833595  94 -----ESFKPFAGQTMAMIFTKPSARTRVSFETGFFRLGGHALYLDPNTIQLGKREPTKDIARVLSGYNDVIMARLFAHS 168
223993805 153 DVLELSEHATVPVINALSDLHHPLQTLADLMALEDHFGDLKGKTLAWVGDGNNVLHDLALGGAKLGMNIRIATPVGYEAD 232
159465437 166 DLLELAEYSSVPIINGLTDYNHPCQIMADALTLLERKGRVEGTKVVYVGDGNNIVHSWLRLATRLSFEFVVVCPPGYEPC 245
145340646 118 QIEELAAYSSVPIVNGLTDYNHPCQILADALTIYECLGRLEGVKVVYVGDGNNIVHSWLNLAAVVPFHFVCVCPEEYTPD 197
168048963 153 DLLDLAEYSKVPVINGLTDYNHPCQIMADVLTINEFIGSIEGLKVVYVGDGNNMVHSWLRLAAVFPFHFVCACPKGYEPD 232
168045637 112 DLLDLAEYSKIPVINGLTDYNHPCQIMADVLTINEFIGNIEGLKIVYVGDGNNMVHSWLRLAAVLPFHFICACPRGYEPD 191
242066266 178 DILDLANYAPVPVINGLTDYNHPCQIMADALTMLEHIGRIENTKVVYVGDGNNIVHSWLLLAAVLPFHFVCACPKGFEPD 257
255070493 164 DVLDLAEYGSVPVVNGLTDFNHPCQIMADALTIKEALGSVKGKKIVYVGDGNNIVHSWLELATVYPIHFVCCCPEGYEPD 243
302810596 160 DLLDLAKYASIPVINGLTDYNHPCQIMADALTIIEHVGRIEGVKVVYVGDGNNIVHSWLRLAAVVPFHFVCACPRGFEPD 239
302814549 168 DLLDLAKYASIPVINGLTDYNHPCQIMADALTIIEHVGRIEGVKVVYVGDGNNIVHSWLRLAAVVPFHFVCACPRGFEPD 247
302833595 169 DLLELAQYSSVPVINGLTDYNHPCQIMADALTLLERKGRIEGTKVVYVGDGNNIVHSWLRLAMRLSFEFVCVCPPGYEPC 248
223993805 233 AGVLDTTRklaaESGTEDVFLTNVaAEAVKGSDVVVTDTWVSM--GQEEEYEKRVKEFDGYQVNATLMKQANPGAVFLHC 310
159465437 246 QSTVEGAR----AAGLSSITVTSD-INAVKGADVIYTDVWASM--GQKETIDERKIAFAPYQVNEKLMALAGAQALFMHC 318
145340646 198 EKTLQKAR----DAGLSTIEISHDpVEGVKGADVIYSDVWASM--GQKDEAEQRKKDFQGYQVNGKMMART-PNAIFMHC 270
168048963 233 AATVERAR----RAGVSRIEISHDpTEAVKGANVIYADVWASM--GQKEDAGNRKKVFQGFQVNEALMKSAGPQAYFMHC 306
168045637 192 AATVERAR----RAGVSKIEIRHDpVEAVKGANVVYADVWASM--GQKEDADNRKSVFQGFQVNEALMKAAGPQAYFMHC 265
242066266 258 AKTVEIAR----SAGISKIEITNDpREAVKGADVVYTDVWASM--GQKEEADYRKQKFQGFTVDEALMEIAGSQAYLMHC 331
255070493 244 PKLLERAQ----AGGISTVEVRCDpADAVRGADVIYGDVWASMnaGQKEEGQSRYKAFDGFQINGKLMAAAGPQCKFMHC 319
302810596 240 KETVNRAT----AAGLSKIEITNDpLEAVKGAHVVYSDVWASM--GQKDQTAARLERFQGFQVNEKLMEAAGSQAYFMHC 313
302814549 248 KETVNRAT----AAGLSKIEITNDpLEAVKGAHVVYSDVWASM--GQKDQTAARLERFQGFQVNEKLMEAAGSQAYFMHC 321
302833595 249 PSTVEGAK----AAGISSISVTSD-INAVKGADVIYTDVWASM--GQKETIDTRKVDFAPYQVNESLMALAGRQALFMHC 321
223993805 311 LPRHPE-EVSDEVFYSDQSLVFPEAENRMWTVMAVMASQLGK 351
159465437 319 LPAERGlETTDGVMESPQSVVFQEAENRMHAQNGILLHCLAA 360
145340646 271 LPAERGlECDDEVMEADYSVVFQQAENRMHAQNAVMLKMLNC 312
168048963 307 LPAERGvEVTDGVIEGPKSIVFPQAENRMHAQNAIMLHCLGF 348
168045637 266 LPAERGvEITDGVIEGPKSIVFPQAENRMHAQNAIMLHCLGF 307
242066266 332 LPAERGvEVTDGAIEAPNSIVFPQAENRMHAQNAIMLHVLGA 373
255070493 320 LPAERGlECTDEVMEAPYSLVFQEAENRMHAQNAIMLDLLGC 361
302810596 314 LPAERDvDVTDAVIESPNSIVFTQAENRMHAQNAIMLHVLGC 355
302814549 322 LPAERDvEVTDAVIESPNSIVFTQAENRMHAQNAIMLHVLGC 363
302833595 322 LPAERGlETTDGVMESPVSVVFQEAENRMHAQNGILLHCLEA 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap