Conserved Protein Domain Family
PLN02339

?
PLN02339: PLN02339 
NAD+ synthase (glutamine-hydrolysing)
Statistics
?
PSSM-Id: 177973
View PSSM: PLN02339
Aligned: 19 rows
Threshold Bit Score: 1169.84
Threshold Setting Gi: 159464365
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224005138  45 STLITLSTCNLNQWALDFTGNLTRILASCTIAKSQGATYRLGPELEICGYGCEDHFLESDTFDHCWESLLQLLED-GATD 123
219117689   9 TSFITVATCNLNQWALDFDGNADRIIESCREAKRLGASYRLGPELEIPGYGCEDHFLENDTFAHCWESLVMILES-GVTD 87 
145350751   1 MRVVAVACCALNQWALDFDGNYARIRESILRAKRLGARYRVGPELETCGYGCEDHFHERDTETHAWEVIAKLCEEkELMR 80 
255090070   1 MRITCLASCVLNQWALDFEGNVKRVKASIQQAKQRGARYRLGPELELPGYGCEDHFLELDTTEHSWESLVELLNG-DETD 79 
255073895   1 MRVTCLATCALNQWALDFEGNLARVKSSISIAKRRGARYRVGPELELPGYGCEDHFLELDTTEHSWECLADLLNG-DETD 79 
303274976   1 MRIARLATCALNQWALDFEGNIARVKASILQAKEAGARYRVGPELEIPGYGCEDHFLEVDTIEHSWECLADLLRD-DTTD 79 
302810938   1 MRLVKVSTCSLNQWAMDFEGNLGRINESIRQARAAGSVLRVGPELEITGYGCDDHFLENDTSAHAWECLAEILSS-DLTY 79 
302780044   1 MRLVNLAVSSLNQWAMSFDHNLSNIKQSIAVARESGAAFRVGPELELTGYGCEDHFLERETCITAWECLAEILSS-GLTD 79 
302788997   1 MRLVKVSTCSLNQWAMDFEGNLGRINESIRQARAAGSMLRVGPELEITGYGCDDHFLENDTSAHAWECLAEILSS-DLTY 79 
302760849   1 MRLVNLAVSSLNQWAMSFDHNLSNTKQSIAIARESGAAFRVGPELELTGYGCEDHFLERETCITAWECLAEILSS-GLTD 79 
224005138 124 GLMCDFGMPVLHSGVRYNCRVICYNREVLLIRPKTSMADNGNYREGRYFTAYTAPSGAyancpEKHLLPTTFY--DNFGQ 201
219117689  88 EMLCDLGMPVLFCGVRYNCRVLVRCRKILLIRPKVAMADNGNYRESRYFTAYRSPIDTk---cEKLILPKVFH--EKFGQ 162
145350751  81 GAVVDVGAPATTRGARYNCRVIIVDGAIAFVRPKRALADDGNYRESRWFTAWTRANEV-----EEFTLPESCArfGMDGK 155
255090070  80 DIVCDVGMPVIHGGVRYNCRVFVLNRKILFIRPKLCLANDGNYRESRWFTAWQHQKKI-----EDHQLPPAIV--AVTGQ 152
255073895  80 EIVCDVGMPVIHGGVRYNCRVFVLNRKILLIRPKLCLANDGNYRETRWFTAWQHQKKI-----EDHQLPPAIV--AVTGQ 152
303274976  80 DILCDIGMPVIHAGVRYNCRVFVLNRQIVLIRPKLCLANDGNYRETRWFTAWQHPKKV-----EQHRLPMSVV--SVTSQ 152
302810938  80 GIVCDIGMPVVSDGVRYNCRVFCLDGKILLIRPKKFLANDGNYRELRWFAAWQHHNSV-----IEYKLPEIIW--SKTSQ 152
302780044  80 GIVCDIGLPVLHEGVLYNCRVFCLDGEILLVRPKKFMANDGNYRELRWFSSWKRHKVV-----TSLNLPECVQ--AIKSQ 152
302788997  80 GIVCDIGMPVVSDGVRYNCRVFCLDGKILLIRPKKFLANDGNYRELRWFAAWQHHNSV-----IEYKLPEIIW--SKTSQ 152
302760849  80 GIVCDIGLPVLHEGVLYNCRVFCLNGEILLVRPKKFMANDGNYRELRWFSSWKRHKVV-----TSLNLPECVQ--AIKSQ 152
224005138 202 RDAPFGLYHLQCADgTTIGCESCEELWTPQATHIDLALRGVEIIGNGSGSHHELRKLSTRMDLMISATRKCGGVYLYSNQ 281
219117689 163 LSAPFGTRFLEFADgVSIGCESCEELWTPRATHIELALQGAEICGNGSGSHHELRKLNQRLELIVSATRKCGGVYLYANQ 242
145350751 156 TSVAFGDGAVVFDD-AGLGCETCEELWTPDAPHIALALNGIEIVSNGSGSHHQLRKLDARMNLIKSASGKAGGVYLYSNQ 234
255090070 153 SYVPFGDAILTFID-ASMGSETCEELFTPAAPHIQMALNGVEVISNGSGSHHQLRKLNTRTDLIRSATGKCGGVYMYANQ 231
255073895 153 SCVPFGDAALEFLD-ASLGSETCEELFTPAAPHIQMALSGVEVISNGSGSHHQLRKLNTRMDLIRSATGKCGGVYMYANQ 231
303274976 153 NYVNFGDAGLDFLD-STLASETCEELFTPNAPHIQLALSGVEIISNGSGSHHQLRKLNTRMDLIQSATAKAGGVYLYANQ 231
302810938 153 KTVTFGDAYVSFLD-TAVAVETCEELFTPWSPHIGLALNGVEIIVNGSGSHHQLRKLNTRIELMQGATHKAGGVYLYANQ 231
302780044 153 RTVPFGDAYLSFQD-TDLASECCEELFTPKQASSGLALHGVQIISNGSGSHHQLRKQRTRLRLMKNVTERCGGVYLYANQ 231
302788997 153 KTVTFGDAYVSFLD-TAVAVETCEELFTPSSPHIGLALNGVEIIVNGSGSHHQLRKLNTRIELMQGATHKAGGVYLYANQ 231
302760849 153 RTAPFGDAYLSFQD-TDLASECCEELFTPKQASSGLALHGVQIISNGSGSHHQLRKQRTRLRLMKNVTERCGGVYLYANQ 231
224005138 282 RGCDGSRLYYDGCAMIVVNGRIIAQAPQFDVQDVNVVTATIDLDDVRSYRASHPAFGIQAARLATDEGGG-----GMYGL 356
219117689 243 RGCDGGRMYYDGGALIVCNGKILAQAQQFSLEDVQVVAATVDLDDVRSYRASIPSFGVQATESQRAQSQRsfiecSDYLV 322
145350751 235 RGCDGGRLYYDGCACIAVNGEIVAQGKQFDVSDVEVVAATVDLDEVQSHRGAFQSMSVQAASVKRIPTVR-----VSGKL 309
255090070 232 RGCDGGRLYYDGCACIAVNGEIVAQGEQFAIQEVEVVTANVDLDAVVGFRGAFQSMAVQASASDKYPTIR-----VPFTL 306
255073895 232 RGCDGGRLYYDGCACIAVNGEIVAQGEQFAIQEVEVVIANVDLDAVVGFRGAFQSMAVQASAGDKYPMIH-----VPFRL 306
303274976 232 RGCDGGRLYYDGCACIAVNGEIVAQGQQFAVQEVEVVTADVDLDTVVGFRGAFQSMAVQAAGCEKHPLIK-----VPFQL 306
302810938 232 QGCDGARLYYDGCATVFVNGDMVVQGSQFSLADVEVLTACVDLDAVSTFRGSISSLREQASQHKFMPYVS-----VDFRL 306
302780044 232 QGCDGGRLYYDGCASVVMNGEVILQGRQFSLHDVDVCTVCLDLDEVVNFRASKSSFREQASERRSMACVN-----VAASL 306
302788997 232 QGCDGARLYYDGCATVFVNGDMVVQGSQFSLADVEVLTACVDLDAVSTFRGSISSLREQASQHKFMPYVS-----VDFRL 306
302760849 232 QGCDGGRLYYDGCASVVMNGEVILQGRQFSLRDVDVCTVCLDLDEVVNFRASKSSFREQASERRSMACVN-----VAASL 306
224005138 357 M-CDDNRPKVTDEALDLKIYAPEEECCLGPACWLWDWLRRSGAAGFFLPLSGGADSSSVAAIVAVMCILVTKAARDDpEG 435
219117689 323 NeGASSLMSATSISQSPRVHCPEEECCLGPACWLWDYLRRSGAAGFFLPLSGGADSSSVAAIVGAMCKMATAAARADpNG 402
145350751 310 C---VSENLKVTPKRAISFHAPEEEIALGPACWLWDYLRRSGASGYFLPLSGGADSASTAAIVGSMCQLVTRAASAG-DA 385
255090070 307 C-PTDYVSQVPHPPCEIRYHLPQEEIALGPACWLWDYLRRSGASGYLLPLSGGADSSSTAAIVGSMCQLATAAAISG-DD 384
255073895 307 C-PNDNVSRIPHSPCDIRYHSPQEEIALGPACWLWDYLRRSGASGYLLPLSGGADSSSTAAIVGSMCQLATAAAVSG-DE 384
303274976 307 C-FENGTSHVPDPPRPVRYHTADEEIANGPACWLWDYLRRSGASGYLLPLSGGADSSSTAALVGSMCQLATSAAASG-DE 384
302810938 307 SrPDDSLLLFPTLPILPRYYLPEEEIALGPACWLWDYLRRCGATGYLLPLSGGADSSSVAAIVGSMCQLVIRAIEEG-DE 385
302780044 307 CeLSSSRSLRISRPLKATRFLPEQEIALGPACWLWDYLRRSGASGYLLPLSGGADSSAVAAIVGSMCQLVIKAIHEN-DK 385
302788997 307 SrPDDSLLLFPTLPILPRYYLPEEEIALGPACWLWDYLRRCGATGYLLPLSGGADSSAVAAIVGSMCQLVIRAIEEG-DE 385
302760849 307 CeLSSSRSLRISRPLKATRFLPEQEIALGPACWLWDYLRRSGASGYLLPLSGGADSSAVAAIVGSMCQLVIKAIHEN-DK 385
224005138 436 DVANDCRRVCRKDEGSsrwVPSTPQEMANCILHTTFMGTENSSEVTLSRAKRLGEAIGSYHLSIKIDLMVKAVLQVFQLT 515
219117689 403 VVATDCRKICRQEGLW---VPSSSHELANFVLHTTYMGTENSSENTTSRARRLGEVIGSYHLSIKIDTMVQAVVKVFSTT 479
145350751 386 IVADDIRRVAQLASDV---PIPSAEELAKMIFTTVYLGTDNSSAETRARAAALANDIGASHLSVAIDVVVTAVVTFFTTV 462
255090070 385 VAAADIRRIARIEGTD---SLPSAKELARILFQTVYLGSENSSAATRSRSSALAAEIGASHLDVRIDAVVAAVIAFFTSV 461
255073895 385 VAVADVRRIAQIDEND---PLPCAKELAHLLFQTVYLGSENSSAATRSRSSALAAEIGASHLDVRIDTVVAAVVAFFTSV 461
303274976 385 RAAADVRRIAQLSDDA---PLPSAKEFAQYLFTTVYLGSENSSVDTRSRSASLAAEIGSSHLDVKIDAVITAVVSFFHSV 461
302810938 386 QVLNDAIRIGNYENGK---VPKSAEEFANRIVFTVYMGSENSSAQTLNRAAQLASQIGASHMDLKIDKIVSALVSLFTSL 462
302780044 386 RVLTDARRIGNYKPGE---EPADSQEFASRIFYTVYMASQNSSTDTQSRAQQLAREIGSNHWNLKIDIVVNALISLFCGL 462
302788997 386 QVLNDAIRIGNYENGK---VPKSAEEFANRIVFTVYMGSENSSAQTLNRAAQLASQIGASHMDLKIDKIVSALVSLFTSL 462
302760849 386 RVLTDARRIGNYKPDE---EPADSQEFASRIFYTVYMASQNSSTETQSRAQQLAREIGSNHWNLKIDMVVNALISLFCGL 462
224005138 516 TGHMPRFASRGGTMTEDLALQNIQARLRMVTAYLFAQLLPWVRGRSGFLLVLGSANVDEGLRGYMTKYDCSSADLNPIGA 595
219117689 480 TGHTPRFSVRGGSVAEDLALQNIQARLRMVTAYLYAQLLPWVRGRSGFLLVLGSANVDEGLRGYMTKYDCSSADLNPIGA 559
145350751 463 TGKTPKFKVDGGSNAENLALQNIQARVRMVLSFLFAQLLPWVRGKSGFLLVLGSANVDEGLRGYMTKYDCSSADVNPIGG 542
255090070 462 TQKTPKFKVDGGSDVENLALQNIQARIRMVLSFVLAQLMPWVRGRGGFLLVLGSANVDEGLRGYMTKYDCSSADINPIGG 541
255073895 462 TQKTPKFRVDGGSNVENLALQNIQARIRMVLSFVLAQLMPWVRGRSGFLLVLGSANVDEGLRGYMTKYDCSSADINPIGG 541
303274976 462 TQRTPKFKVDGGSTVENLALQNIQARIRMVLSFVLAQLMPWVRGKNGFLLVLGSANVDEGLRGYMTKYDCSAADVNPIGG 541
302810938 463 TGKVPRYKVDGGSTAENLALQNLQARIRMVIAYMLASLLPWVKGKRGFFLVLGSANVDEGLRGYLTKYDCSSADLNPIGG 542
302780044 463 TGRIPRYKVDSGTPVENLALQNLQARVRMVISYMLASLLPWVGRKKGFLLVLGSSNADESIRGYMTKYDCSSADINPIGG 542
302788997 463 TGKVPRYKVDGGSTAENLALQNLQARIRMVIAYMLASLLPWVKGKRGFFLVLGSANVDEGLRGYLTKYDCSSADLNPIGG 542
302760849 463 TGRIPRYKVDSGTPVENLALQNLQARVRMVISYMLASLLPWVGRKKGFLLVLGSSNADESIRGYMTKYDCSSADINPIGG 542
224005138 596 ISKGDLKRMLIFLTKEYpGFEVLSEIANAPPTAELRPIDaatataeAGHSQTDEEDMGMTYEELGYFGRLRKISRCGPVS 675
219117689 560 ISKGDLKKMLEWAAKTY-DWEILAEIAGAPPTAELRPKGegv-gatTEHSQLDEEEMGMSYEELGFFGTLRKISRCGPVS 637
145350751 543 ISKADLRSFLRWGAMNL-GYPTLAEVEKAPPTAELEPIR-------DDYVQTDEEDMGMSYDDLGVYGRLRKIARLGPVA 614
255090070 542 ISKRDLRSFLRWGADKL-GYPTLALVEEAPPTAELEPIR-------DDYVQTDEEDMGMTYEELGVFGRLRKISRLGPVE 613
255073895 542 ISKGDLRSFLRWAADRL-GYPTLAEVEEAPPTAELEPIR-------DDYVQTDEEDMGMTYEELGVYGRLRKISRLGPVE 613
303274976 542 ISKGDLRSFLRWGAVNL-GFPTLASVEEAPPTAELEPIR-------DDYVQNDEDDMGMTYEELGVYGRLRKISRLGPVE 613
302810938 543 ISKQDLRSFLRWCVNNL-HYPILAEVVSAPPTAELEPIR-------ENYSQTDEEDMGMTYEELSMYGRLRKIFHCGPVS 614
302780044 543 ISKRDLRAFLRWGAQKL-GFPVLAQVEAAPPTAELEPSS-------DGYKQTDEEDMGMTYDELNSFSRLRKVDRLGPVA 614
302788997 543 ISKQDLRSFLRWCANNL-HYPILAEVVSAPPTAELEPIR-------ENYSQTDEEDMGMTYEELSMYGRLRKIFHCGPVS 614
302760849 543 ISKRDLRAFLRWGAQKL-GFPVLAQVEAAPPTAELEPSS-------DGYKQTDEEDMGMTYDELNSFSRLRKVDRLGPVA 614
224005138 676 MFKKL-MVTWNT--MAPSEVAAKVKRFFYYYSVNRHKMTTITPAYHAEAYSPDDNRFDLRQFLYNTKWTRQFAVIDEMVA 752
219117689 638 MFRKL-CVIWNH--LPPHEVGAKVKRFFYFYSINRHKMCTITPSYHAEGYSPDDNRFDLRQFLYNARWPRQFSVIDKLVE 714
145350751 615 MFKRLyTVEWADrgLSASEIAEKVKKFFFFYSCNRHKMTTLTPSYHAENYSPDDNRFDQRQFLYNVRWPWQFRKIDEIVE 694
255090070 614 MFKRL-LHEWKHr-ASPEEIAAKVKSFFFYYSSNRHKMTTLTPSYHAENYSPEDNRFDLRPFLYNVKWPWQFRKIDEVVM 691
255073895 614 MFKRL-LHEWRDr-ASPTEIAAKVKSFFYHYSCNRHKMTTLTPSYHAENYSPEDNRFDLRPFLYNVRWPFQFRKIDQLAG 691
303274976 614 MFRRL-LLEWKDr-FSVDEIAEKVKRFFFFYSANRHKMTTLTPSYHAENYSPEDNRFDLRPFLYNVRWPWQFRKIDEIAR 691
302810938 615 MFKNL-CHRWHGk-LDPGQVAIKVKDFFRFYAINRHKMTTITPAYHAENYSPDDNRFDQRQFLYNTRWPWQFKKIDEIVE 692
302780044 615 MFQRL-CQEWNG--LHHKQVANKVKDFFRYYSINRHKMTTLTPSYHAESYSPDDNRFDQRQFLYDSSWSRQFMKIDELVA 691
302788997 615 MFKNL-CHRWHGk-LDPGQVAIKVKDFFRFYSINRHKMTTITPAYHAENYSPDDNRFDQRQFLYNTRWPWQFKKIDEIVE 692
302760849 615 MFQRL-CQEWNG--LHHKQVANKVKDFFRYYSINRHKMTTLTPSYHAESYSPDDNRFDQRQFLYDSSWSRQFMKIDELVA 691
224005138 753 NNPDEDLHD 761
219117689 715 GQEDLTANE 723
145350751 695 REKSS---- 699
255090070 692 ARERSYQES 700
255073895 692 AAE------ 694
303274976 692 KANAEKAD- 699
302810938 693 RAAKTVVTE 701
302780044 692 KMKNETPL- 699
302788997 693 RAAKRPVVT 701
302760849 692 KMKNETPL- 699
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap