Conserved Protein Domain Family
PLN02338

?
PLN02338: PLN02338 
3-phosphoshikimate 1-carboxyvinyltransferase
Statistics
?
PSSM-Id: 177972
View PSSM: PLN02338
Aligned: 20 rows
Threshold Bit Score: 767.759
Threshold Setting Gi: 223997738
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168016496   1 MEEITLQPIKTISGTIKLPGSKSLSNRTLLLAALSEGTTVVENLLDSEDVRYMVAALQTLGFKIEEDRAANRLVIEGEGG 80 
145356716   1 MEQLTLKPMKKIEGTVRLPGSKSLSNRILLLAALAEGTTKVENLLDSDDIRYMVDALKVLGLSFTEDRENNILEITGCGG 80 
159489926  69 VEELTIQPVKKIAGTVKLPGSKSLSNRILLLAALSEGTTLVKNLLDSDDIRYMVGALKALNVKLEENWEAGEMVVHGCGG 148
219112561  45 TETLTVKPIKSLDGTVTLPGSKSLSNRCLLLAALSEGKTRVNNLLDSDDICYMLQALEQLAVPVERHSDDSVT-VTGKAG 123
168037771  27 VEEITLQPIKTISGKIKLPGSKSLSNRTLLLAALSEGETVVENLLDSEDVRYMIGALKTLGYDIHEDRAENRCVIKGSGG 106
224063774  77 VPEIVLQPIKDISGTVTLPGSKSLSNRILLLAALSEGTTVVDNLLNSDDVHYMLGALRTLGLHVEDNKKLKQAIVEGCGG 156
255541256  77 APEIVLQPIKEISGTVTLPGSKSLSNRILLLAALSEGTTVVDNLLNSDDVRYMLGALRTLRLRVEDNSELKRAIIEGCGG 156
302780697  11 LEKLELKPVTTISGTVKLPGSKSLSNRTLLLAALAEGTTFVENLLDSDDVRYMVAALKTLGLDVSEDRPNNTATVVGCGG 90 
302830294  66 VEELTLQPVKKIEGHVKLPGSKSLSNRILLLAALAEGTTSVKNLLDSDDIRYMVGALKALNVQLEENWETGEMVVHGCGG 145
302822768  11 LEKLELKPVTTISGTVKLPGSKSLSNRTLLLAALAEGTTFVENLLDSDDVRYMVAALKTLGLDVSEDRANNTATVVGCGG 90 
168016496  81 VFPIARDAEKSgetVNLFLGNAGTAMRPLTAAVVAAGGNVSYVLDGVPRMRERPIIDLVAGLQQLGADVKCTEEyPNCPP 160
145356716  81 KLPVEG--------AELFLGNAGTAMRPLTAAVAAAG-KGTFILDGVERMRERPIQDLVDGLVQLGVKAECTMG-TGCPP 150
159489926 149 RFDSAG--------AELFLGNAGTAMRPLTAAVVAAG-RGKFVLDGVARMRERPIEDLVDGLVQLGVDAKCTMG-TGCPP 218
219112561 124 PINSPTPEKV----CELFLGNAGTAMRPLAAALCM--GKGKFLLDGVSRMRERPIADLVDGLKQLGADVSCVEE-SGCPP 196
168037771 107 VFPVARDAEERgqvVKLFLGNAGTAMRPLTAAVTAAGGNASYELDGVPRMRERPIVDLVMGLQQLGADVTCTEDyPNCPP 186
224063774 157 QFPVGKEANVD---VELFLGNAGTAMRPLTAAVTAAGGNSSYILDGVPRMRERPIGDLVIGLQQLGADVSCSP--TNCPP 231
255541256 157 SFPVGRESKTD---VELFLGNAGTAMRPLTAAVTAAGGNSSYILDGVPRMRERPIGDLVAGLQQLGADVTCS-S-TNCPP 231
302780697  91 KFPVKEQNGEG---IELFLGNAGTAMRPLTAAVAVAGRNARYILDGVPRMRERPIGDLVDGLKQLGADVECNPS-TRCPP 166
302830294 146 RFNSSG--------AELFLGNAGTAMRPLTAAVVAAG-RGKFVLDGVARMRERPIQDLVDGLVQLGVDAKCTLG-TGCPP 215
302822768  91 KFPVKEQNGEG---IELFLGNAGTAMRPLTAAVAVAGRNARYILDGVPRMRERPIGDLVDGLKQLGADVECNPS-TRCPP 166
168016496 161 VIINdkssgskSKGGLPGGTVHLSGKVSSQYLSALLMAAPLAL------GDVEIVMIDKLVSVPYVDMTLRLMERFGVKV 234
145356716 151 VKVE--------ANGLPGGRVELSGSVSSQYLTALLMAAPLCE------GSIEIVIVDELISKPYVEMTITLMERFGVKV 216
159489926 219 VEVN--------SKGLPTGKVYLSGKVSSQYLTALLMAAPLAVpggaggDAIEIIIKDELVSQPYVDMTVKLMERFGVVV 290
219112561 197 VTIN--------ANGLQGGCASISGKMSSQFLSSLLMAAPLVD------GDINISIKDELISAPYVALTIGLMKKFGVNV 262
168037771 187 VLIN-------AKGGLPGGTVRLSGKVSSQYLSALLMAAPLAL------GDVEIIMVDKLVSVPYVDMTLRLMERFGVKV 253
224063774 232 VRIN-------ANGGLPGGKVKLSGSISSQYLTALLMAAPLAL------GDVEIEIVDKLISVPYVEMTLKLMERYGVFV 298
255541256 232 VRVN-------GKGGLPGGKVKLSGSISSQYLTALLMAAPLAL------GDVEIEIIDKLISIPYVEMTLKLMERYGVFV 298
302780697 167 VTVN-------AKGGLPGGNIKLSGSVSSQYLTALLLSAPLAT------GDVEIEIVDKLISVPYVDMTLKLMERFGVSV 233
302830294 216 VEVN--------SNGLPTGKVYLSGKVSSQYLTALLMAAPLAVpggpggDAIEIIIKDELVSQPYVDMTVKLMERFGVRV 287
302822768 167 VTVN-------AKGGLPGGNIKLSGSISSQYLTALLLSAPLAT------GDVEIEIVDKLISVPYVDMTLKLMERFGVSV 233
168016496 235 ERHGGWE---RFSIKGGQTYKSPGNAYVEGDASSASYFLAGAAVTGGTITVEGCGTSSLQGDVKFAAVLEKMGAKVEWTE 311
145356716 217 EKADDLQ---SFKIQGGQKYISPGSAFVEGDASSASYFLAGATITGGTVTVIGCGSESIQGDTNFAYTMEQMGATLEWGP 293
159489926 291 ERLNGLQ---HLRIPAGQTYKTPGEAYVEGDASSASYFLAGATITGGTVTVEGCGSDSLQGDVRFAEVMGLLGAKVEWSP 367
219112561 263 DIEGDMDgapSFKIASSEKYISPKSILVEGDASSASYFVAGAAITGGTVTVRGCGSESVQGDVAFANVMEQMGATITWAP 342
168037771 254 DRHDGWE---RFSIKGGQTYKSPGSAYVEGDASSASYFLAGAAVTGGTITVEGCGTTSLQGDVKFAEVLEKMGATVQWGD 330
224063774 299 EHSDNWD---RFFVRGGQKYKSPKNSFVEGDASSASYFLAGAAITGGTITVEGCGMDSLQGDVKFAEVLEKMGAKVTWTK 375
255541256 299 EHSSSWD---RFFIRGGQKYKSPGNSYVEGDASSASYFLAGAAVTGGTITVEGCGTSSLQGDVKFAEVLEQMGAKVTWTE 375
302780697 234 QRYGGWE---KFTIAGNQTYRSPGKAYVEGDASSASYFLAGAAITGGTVKVEGCGTTSLQGDVKFAKVLEKMGATVEWTE 310
302830294 288 ERLDGLQ---HLRIPAGQRYVSPGEAYVEGDASSASYFLAGATITGGTITVEGCGSDSLQGDVRFAEVMGLLGAKVEWSP 364
302822768 234 QRYGAWE---KFTIAGNQTYRSPGKAYVEGDASSASYFLAGAAITGGTVKVEGCGTTSLQGDVKFAKVLEKMGATVEWTE 310
168016496 312 HSVTVTGAPVDPRTGKRLKSIDVDMNAMPDVAMTLAVLGLFSDGPVAIRDVENWRVKETERMRAIVDELTKLGAEVEEGQ 391
145356716 294 NSVTCTGP------KGPLKAIDVNMNAMPDAAMTLAVAALFADGITTIRDVASWRVKETERMIAICTELRKLGCDVFEGA 367
159489926 368 YSITITGPSAF---GKPITGIDHDCNDIPDAAMTLAVAALFADRPTAIRNVYNWRVKETERMVAIVTELRKLGAEVEEGR 444
219112561 343 ESITVTRDP-----SVKLKGVDVDCGKIPDAAMTLAVAALFAEGPTTIRNVYSWRLKETERMKAIVAECTKLGAIVEEFE 417
168037771 331 HTVTVTGAPADFTTGKRLKAIDVDMNAMPDVAMTLAVLGLFADGPVAIRDVENWRVKETERMRAIVDELTKLGAEVEEGQ 410
224063774 376 NSVTVTGPPRDSSGQKHLRAVDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGP 455
255541256 376 NSVTVTGPPRNSPTQKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGP 455
302780697 311 SSVTVTGPPVSAKTGRRLKGIDVNMNAMPDVAMTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGP 390
302830294 365 YSITITGPSAS---GQPITGIDHDCNDIPDAAMTLAVAALFADRPTAIRNVYNWRVKETERMVAIVTELRKLGATVEEGR 441
302822768 311 SSVTVTGPPVSTKTGRRLKGIDVNMNAMPDVAMTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGP 390
168016496 392 DYCIVTPPKRITPA-------KIETYDDHRMAMAFSLAACGDVPITILDPGCTRKTFPTYFTELEKLCQH 454
145356716 368 DYCVITPPHKLDPPakmkanvDIDTYDDHRMAMAFALAACGDVDVVINDPKCTKKTFPTYFDVLKSVAK- 436
159489926 445 DYCIVTPPPGGVKGvka--nvGIDTYDDHRMAMAFSLVAAAGVPVVIRDPGCTRKTFPTYFKVFESVAQH 512
219112561 418 DYCIIHPPKDNIINdn----vLIETYDDHRMAMTFSLVACGGVSVIINDPGCTGKTFPTYFEMLESISSH 483
168037771 411 DYCIVTPPKRITPA-------KVDTYDDHRMAMAFSLAACGDTAITIRDPGCTRKTFPTYFTELEKLCQH 473
224063774 456 DYCVITPPEKLNVT-------EIDTYDDHRMAMAFSLAACGEVQVTIKDPGCTRKTFPDYFEVLERYTKH 518
255541256 456 DYCVITPPEKLNVT-------EIDTYDDHRMAMAFSLAACGDVPVTIKDPGCTRKTFPDYFEVLQRFTKQ 518
302780697 391 DYCIITPPKTIKPA-------AIDTYDDHRMAMAFSLAACGDTPITINDPSCVRKTFPTYFDVFSSMATL 453
302830294 442 DYCIVTPPPGGVAGvkp--nvAIDTYDDHRMAMAFSLVAAAGVPVIIRDPGCTRKTFPTYFKVFESVAKH 509
302822768 391 DYCIITPPKTIKPA-------AIDTYDDHRMAMAFSLAACGGTPITINDPSCVRKTFPTYFDVFSSMATL 453
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap