Conserved Protein Domain Family
PLN02336

?
PLN02336: PLN02336 
phosphoethanolamine N-methyltransferase
Statistics
?
PSSM-Id: 177970
View PSSM: PLN02336
Aligned: 21 rows
Threshold Bit Score: 921.456
Threshold Setting Gi: 225424283
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224135553   1 MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAGQVVALDFIESAIKKNENING 80 
115439355  26 EEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNESING 105
168021528  15 KEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRFTGELAKHAGHVLAMDFMENLIKKNEDVNG 94 
225424279  16 MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFTGELAKQAGQVLAIDFIESVIRENEVING 95 
225456147  17 AEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLELGAGIGRFTGELAQKAGQVISLDFIESVIKKNESING 96 
242054095  26 EEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGRFTGELAKTSGHVFAVDFIESAIKKNESTNG 105
242054097  28 EEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFEGKSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESING 107
224118660   1 MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKASQVVALDFIESAIKKNENING 80 
242091267  37 EEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNQSING 116
255582633  18 IEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLEFGAGIGRFTGELAQKAGQLVAVDFIESVIKKNENING 97 
224135553  81 HYKNVKFMCADVTSPDLNISEGSVDLIFSNWLLMYLSDKEVENLVERMVKWVKVDGFIFFRESCFHQSGDSKRKYNPTHY 160
115439355 106 HHKNASFMCADVTCPDLMIEDNSIDLIFSNWLLMYLSDEEVEKLVKRMVRWLKVGGYIFFRESCFHQSGDSKRKVNPTHY 185
168021528  95 HYNNIDFKCADVTSPDLNIAAGSADLVFSNWLLMYLSDEEVKGLASRVMEWLRPGGYIFFRESCFHQSGDHKRKNNPTHY 174
225424279  96 RFKNTKFVCADVTSPDLDISPGSVDLIFSNWLLMYLSDKEVEDLAERMVKWLKVGGFLFFRESCFHQSGDFKRKKNPTHY 175
225456147  97 HYKNVKFMCADVASPELNFSAESVDLIFSNWLLMYLSDKEVEELVERMVKWLKVGGFIFFRESCFHQSGDSKRKVNPTHY 176
242054095 106 HYDNTSFMCADVTSPNLMIEANSIDLIFSNWLLMYLSDEEIDKLVERMVKWLKVGGYIFFRESCFHQSGDLERKVNPTHY 185
242054097 108 HYKNASFMCADVTSEDLVLPASSIDLIFSNWLLMYLSDEEVEQLVQRMVKWLKIGGYIFFRESCFHQSGDSKRKVNPTHY 187
224118660  81 HYKNVKFMCADVTSPDLNFSEGSVDLIFSNWLLMYLSDKEVENLVERMVKWLKVGGFIFFRESCFHQSGDSKRKYNPTHY 160
242091267 117 HHKNITFKCADVTSPELKIEDNSVDLIFSNWLLMYLSDEEVEKLVGKMVKWLKVGGHIFFRESCFHQSGDSKRKVNPTHY 196
255582633  98 HHKNVKFMCADVTSQGLKFSEESVDLIFSNWLLMYLSDEEVVNLAERMVKWLKVGGYIFFRESCFHQSGDSKRKHNPTHY 177
224135553 161 REPRFYTKVFKECHTRDGSGDSFELSLVGCKCISAYVKNKKNQNQamkldhlilwICWIWQKVSSYEDKG--FQRFLDNV 238
115439355 186 REPRFYTKVFKECQALDQDGNSFELSVLTCKCVGAYVKSKKNQNQ----------ICWLWQKVDSTEDRG--FQRFLDNV 253
168021528 175 RQPNEYTNIFQQAYI-EEDGSYFRFEMVGCKCVGTYVRNKRNQNQ----------VCWLWRKVQSDGPESecFQKFLDTQ 243
225424279 176 REPRFYTKVFKECHMSDDFGNSSEFSLITFKCVGAYVRNKKNQNQ----------IYWLWQKVNSQNDKG--FQRFLDNV 243
225456147 177 REPRFYTKVFKECQTHDCSGNLYELSLVGCKCIGAYVRNKKNQNQ----------ICWLWQKVSSQDDKG--FQKFLDNV 244
242054095 186 REPRFYTKVFKECQTFNQDGTSFKLSLVTFKCIGAYVNIKKDQNQ----------ICWLWQKVNSLEDGG--FQSFLDNV 253
242054097 188 REPSFYTKVFKECHTFDQDGNSFELSLVTCKCIGAYVKNKKNQNQ----------ICWLWQKVQSTEDKG--FQRFLDNV 255
224118660 161 REPRFYTKVFKECHTFDGSGNSFELSLIGCKCISAYVKNKKNQNQaikl--dpfdICWIWQKVSSNDDKG--FQRFLDNV 236
242091267 197 REPRFYTKVFKEGHSFDQDGGSFELSLVTCKCIGAYVKNKKNQNQ----------ICWLLEKVKSTEDRD--FQRFLDNV 264
255582633 178 REPRFYTKVFKECHASDGSGNSFELSLIGCKCIGAYVRNKKNQNQ----------ICWVWQKVSSQDDKG--FQRFLDNV 245
224135553 239 QYKSNGILRYERVFGQGYVSTGGI-ETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMAENFDVEVVGIDLSINMISFALE 317
115439355 254 QYKASGILRYERIFGEGFVSTGGI-ETTKEFVDRLDLKPGQNVLDVGCGIGGGDFYMADKYDVHVVGIDLSINMVSFALE 332
168021528 244 QYTSTGILRYERIFGEGFVSTGGI-ETTKAFVSMLDLKPGQRVLDVGCGIGGGDFYMAEEYDAEVVGIDLSLNMISFALE 322
225424279 244 QYKCRGILRYERVFGEGFVSTGGL-ETTKEFVTKLDLKPSQKVLDVGCGIGGGDFYMAEDFDVEVVGIDLSINMISIALE 322
225456147 245 QYKCNGILRYERVFGEGFVSTGGI-ETTKEFVGKLDLKPGQKVLDVGCGIGGGDFYMAENFDVEVVGIDLSINMVSFALE 323
242054095 254 QYKATGILRYERIFGDGYVSTGGV-ETTKEFVDKLDLKPGQKVLDVGCGIGGGDFYMAEKYGTHVVGIDLSINMILFALE 332
242054097 256 QYKTSGILRYERIFGEGYVSTGGI-ETTKEFVDKLDLKPGHKVLDVGCGIGGGDFYMAENYDAHVVGIDLSINMVSFALE 334
224118660 237 QYKSNGILRYERVFGQGFVSTGGMaETTKEFVEKLDLKPGQKVLDVGCGIGGGDFYMAENFEVEVVGIDLSVNMISFALE 316
242091267 265 QYKTSGILRYERVFGEGYVSTGGI-ETTKEFVGMLDLKPGKKVLDVGCGIGGGDFYMAENYDVHVLGIDLSVNMVSFAIE 343
255582633 246 QYKSNGILRYERVFGPGFVSTGGV-ETTKEFVAKLDLKPGQKVLDVGCGIGGGDFYMAENFDVEVIGIDLSINMISFALE 324
224135553 318 RAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCKCDGTPSPEFAEYIKQ 397
115439355 333 RAIGRKCSVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCKCPGKPSEEFAAYIKQ 412
168021528 323 RSIGRKCAVEFEVGDCTKINYPHASFDVIYSRDTILHIQDKPALFQRFYKWLKPGGRVLISDYCRAPQTPSAEFAAYIQQ 402
225424279 323 RAIGRKCLVEFEVADCTKKTYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLITDYCKRAGPPSPEFQEYIEQ 402
225456147 324 RAIGLKCSVEFEVADCTKKSYPDNTFDVIYSRDTILHIQDKPALFKSFFKWLKPGGKVLISDYCKRAGPPSSEFSEYIKQ 403
242054095 333 RSIGRKCSVEFEVADCTTKTYPDHMFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCKSPGKPSEEFAAYIKQ 412
242054097 335 RAIGRSCSVEFEVADCTTKTYPENTFDVIYSRDTILHIQDKPSLFKSFFKWLKPGGKVLISDYCRSPGKPSEEFAAYIKQ 414
224118660 317 RAIGLKCSVEFEVADCTTKTYPDNTFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCKCAGTPSPEFAEYIKQ 396
242091267 344 RAIGRKCSVEFEVADCTTKDYPEDSFDVIYSRDTILHIQDKPALFRSFFKWLKPGGKVLISDYCKNPGKPSEEFAAYIKQ 423
255582633 325 RAIGLKCAVEFEVADCTKKTYPDNSFDVIYSRDTILHIQDKPALFRSFYKWLKPGGKVLISDYCKSAGTPSSEFAEYIKQ 404
224135553 398 RGYDLHDVKAYGQMLRDAGFDEVVAEDRTDQFNKVLQRELNAIEKDKDEFIHDFSEGDYNDIVGGWKAKLIRSSSGEQRW 477
115439355 413 RGYDLHDVRAYGQMLENAGFHDVIAEDRTDQFLDVLERELAKVEKNKNEFVSDFSQEDYDAIVNGWKAKLQRSSAGEQRW 492
168021528 403 RGYDLHSVQKYGEMLEDAGFVEVVAEDRTDQFIEVLQRELATTEAGRDQFINDFSEEDYNYIVSGWKSKLKRCSNDEQKW 482
225424279 403 RGYDLHDVKAYGQMLKDAGFCEVIAEDRTEQFIKVLQREMDAVEKNKDEFIQDFSEEDYNEIVGGWKSKLNRSSSGEQRW 482
225456147 404 RGYDLHDVEAYGEMLRDAGFIEVIAEDRTDQFLQVLQRELNAVETNKNEFVQDFSEDDYNEIVDGWKAKLMRSSSGEQRW 483
242054095 413 RGYDLHDVEAYGQMLKNAGFSHVIAEDRTDQFLSVLQKELDKFEKNKDDFLSEFAQGDYDDIVNGWKAKLQRTSAREQRW 492
242054097 415 RGYDLHDVEAYGQMLKSAGFRDVIAEDRTDQFLGVLEKELAKFEKNKDDFLSDFTQEDYDDIVNGWKAKLQRSSAGEQRW 494
224118660 397 RGYDLHDVKAYGQMLRDAGFDEVIAEDRTDQFNQVLLRELKAIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRW 476
242091267 424 RGYDLHDVKAYGQMLKDAGFHDVIAEDRTEQFLNVLRRELGEVEKNKEAFLADFTQEDYDDIVNGWNAKLKRSSAGEQRW 503
255582633 405 RGYDLHDVKAYGQMLKDAGFDDVIAEDRTDQFNQVLKRELDVIEKEKDEFIHDFSEEDYNDIVGGWKAKLIRSSSGEQRW 484
224135553 478 GLFIAKKK 485
115439355 493 GLFIATK- 499
168021528 483 GLFIAYKA 490
225424279 483 GLFIAKKN 490
225456147 484 GLFIAKKK 491
242054095 493 GLFVATK- 499
242054097 495 GLFIATK- 501
224118660 477 GLFIAKKK 484
242091267 504 GLFIATK- 510
255582633 485 GLFIAKKN 492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap