Conserved Protein Domain Family
PLN02335

?
PLN02335: PLN02335 
anthranilate synthase
Statistics
?
PSSM-Id: 177969
View PSSM: PLN02335
Aligned: 23 rows
Threshold Bit Score: 393.008
Threshold Setting Gi: 303291047
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15221810    1 MAESNSIPSVVINSSKQN--GPIIVIDNYDSFTYNLCQykqnfencylflqYMGELQCHFEVYRNDELTVEELKRKNPRG 78 
145351249  29 WTGRRRRAGAAARATREDaaRPVVIIDNYDSFTYNLSQ-------------YLGDCGCAHAVYKNDEVTVEEVRAMRPRG 95 
159463238  21 RRAPARVCRPVASAAAAK--GPVVVVDNYDSFTYNLCQ-------------YLGDFGVDYVVYKNDEKTVDEIRAMNPRG 85 
168063895  14 QAAVGVKERVLERNDKEK--GSVVVIDNYDSFTYNLCQ-------------YLGDLGCKIEVYRNDEITVEEIRKKKPRG 78 
168046986   1 ----------------KR--GSVIVIDNYDSFTYNLCQ-------------YLGDLGCKIEVYRNDEITVEELKAKKPRG 49 
115458822  62 AGAAAATPVADIEERRATekQPIIVIDNYDSFTYNLCQ-------------YMGELGLNFEVYRNDELTIEDVKRKNPRG 128
115454969  55 VEGENAFDGVKQDT------RPIIVIDNYDSFTYNLCQ-------------YMGEVGANFEVYRNDDITVEEIKKISPRG 115
242033181  56 VEGGDAFVGVKQNT------RPIIVIDNYDSFTYNLCQ-------------YMGEVGANFEVYRNDEITVEEIKKISPRG 116
255082786  21 LVKDDG--------------RPVIIIDNYDSFTYNLSQ-------------YLGDLGQDHVVFKNDEKTVEEIRAMNPKG 73 
303291047  51 RGVARRVGVVVLAAASKGddRPVVIIDNYDSFTYNLSQ-------------YLGDLGCEHVVYKNDEKTVAEIAAMNPKG 117
15221810   79 VLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSMVHYDEKGEeGLFSGLS--- 155
145351249  96 VMVSPGPGRPEDSGISLDVVRELGPEFGVFGVCMGHQCIGQVFGGDIVRAPTGLMHGKSSPVTHRTDLD-TVLSGLP--- 171
159463238  86 ILVSPGPGRPIDSGISLQTVRELGPDFPLFGVCMGHQCIGEAFGGDVVRAPCGVMHGKTSPVFHTNV---GLLEGLP--- 159
168063895  79 ILISPGPGTPQDSGISLEIVRKLGPTIPLFGVCMGLQCMGEAFGGKIVRAPNGVMHGKTSPVFYDEGGEpGVLDGLP--- 155
168046986  50 VLISPGPGTPQDSGISLQIVRELGPTIPLFGVCMGLQCMGEAFGGKIVRAPNGVMHGKTSPVFHDEKGEpGLLDGLP--- 126
115458822 129 ILISPGPGEPQDSGISLQTVLELGPTIPIFGVCMGLQCIGEAFGGKIIRAPSGVMHGKSSPVRYDEELGkALFNGLP--- 205
115454969 116 ILISPGPGTPQDSGISLQTVQDLGPSTPLFGVCMGLQCIGEAFGGKVVRSPYGVVHGKGSLVHYEEKLDgTLFSGLP--- 192
242033181 117 ILISPGPGTPQDSGISLQTVTELGPSIPLFGVCMGLQCIGEAFGGKVVRSPYGVVHGKGSLVHYDEKLDgTLFSDLP--- 193
255082786  74 IMVSPGPGRPEDSGISLEACEKLGPEFGVFGVCMGHQCIGQVFGGTIVRAPCGLMHGKSSPVWHTEDAA-TMLAGLP--- 149
303291047 118 VMVSPGPGRPEDSGISLEACEKLGPEFGVFGVCMGHQCIGQVFGGTVVRAPCGLMHGKSSPVWHTEE-EgQLLHGLPrrv 196
15221810  156 ----NPFIVGRYHSLVIEKDTFPSDELEVTAWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKDS 231
145351249 172 ----SPFQAARYHSLVISRDNFPEDALEVTAWTEDGTVMAVKHKAYPWIQGVQFHPESIITENGLLIVKNWVKMINDRAA 247
159463238 160 ----NPFEACRYHSLVIKRDTIPED-LEVTAWTEDGTIMGVRHKKYPHIQGVQFHPESIITQSGKKIVENFVKTL----- 229
168063895 156 ----SPFTACRYHSLVIEEATFPADQLQATAWTEDGLVMAVRHRVYKHIQGVQFHPESIRTQNGMQIVSNFLKILDWKEA 231
168046986 127 ----SPFTACRYHSLVIEEATFPADQLEVTAWTEDGLVMGVRHKVYKHIQGVQFHPESIRTQNGMQIVGNFLKILDRKEA 202
115458822 206 ----NPFTAARYHSLVIEQETFPHDALEATAWTEDGLIMAARHKKYRHIQGVQFHPESIITPEGKRIILNFVRFIEELEK 281
115454969 193 ----NPFQAGRYHSLVIEKDSFPHDALEITAWTDDGLIMAARHRKYKHIQGVQFHPESIITTEGRLMVKNFIKIIEGYEA 268
242033181 194 ----NPFQAGRYHSLVIEKDSFPHDTLEIVAWTDDGLIMAARHRIYKHIQGVQFHPESIITTEGRLMVKNFIKIIEDY-- 267
255082786 150 ----SPFQAARYHSLVISRDDFPDDELEVTAWTEDETIMAVRHRRYPKIQGVQFHPESIITENGLTIIRNWVALINA--- 222
303291047 197 pisrRPFEAARYHSLVISREGFPEDELEVTAWTKDQTIMAVKHRKYPKIQGVQFHPESIITENGLHIIRNWVNLIDA--- 273
15221810  232 EKLT 235
145351249 248 ESEL 251
159463238     ----    
168063895 232 LEAE 235
168046986     ----    
115458822 282 QRAG 285
115454969 269 LNCL 272
242033181     ----    
255082786     ----    
303291047     ----    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap