Conserved Protein Domain Family
PLN02331

?
PLN02331: PLN02331 
phosphoribosylglycinamide formyltransferase
Statistics
?
PSSM-Id: 177965
View PSSM: PLN02331
Aligned: 17 rows
Threshold Bit Score: 340.517
Threshold Setting Gi: 303285652
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159471718   1 RLAVFVSGGGSNFKAIHAAIQDGRINGTVAVVVSDVPGCGGVTYAQQHGIPTLTYPVVKKGDfvgQGLTAAQLVDGLKNA 80 
115477130  78 RLAVFVSGGGSNFRAIHDAALGGEVNGDVVALVTDKPGCGGAEHARGNGIPVVVFPKSKSAP---EGVSIDELLNALREL 154
168041124  71 KLAVFVSGGGSNFRAIHAGCKENAIFGDVAYVVSDKPGCKGCEYAIENNIPVLAYPKGKHAP---EGISPTELVEQLRGA 147
145348112   3 NLAVFVSGGGSNMRAIHDACERGEVRGRVACVVTNAATCGGAEWARERGIPVLIYPAKKNET---GGLTADALVDALTRE 79 
242075832  84 RLAVFVSGGGSNFRAIHEAALGGAVHGDVVALVTDKPGCGGAEYARSNGIPVLVFPKSKSAP---EGISVAQLLDTLRGY 160
225469646  88 NLAVFVSGGGSNFRSIHEACLRGSVHGDIVVLATNKSGCGGAEYARGKGIPVILFPKAKDEP---EALSPNDLVAALRGF 164
255072241  51 KVAVFVSGGGSNLRALHAAMEDGRVNAEVAVVVSNIPSCGGVEWSRERGIPTLTYPPKKGE----DGLTPDALVAQLRDA 126
302763025   4 RLAVFVSGGGSNFRSIHKATIDGTVLGDVVIVVSDKPECKACEYAREHGISVAYYPRTKFAP---DGVSPNELVEILRHQ 80 
302809645   4 RLAVFVSGSGSNFRSIHKATIDGTVLGDVVIVVSDKPECKACEYAREHGISVAYYPRTKFAP---DGVSPNELVEILRHQ 80 
302849794  88 RLAVFVSGGGSNFKAIHAACLDGRINGRVVAVVSDVPSCGGVNYAREHGIPTVTYPIVKKGEflgQGLTAEQLVEALKTA 167
159471718  81 yKCDYVILAGYLKLIPQELCRAFPRAMLNIHPGLLPSFGGKGYYGERVHKAVIASGARFSGPTVHFVDEEFDTGPILAQR 160
115477130 155 -RVDFILLAGYLKLIPVELVQEYPKSILNIHPSLLPAFGGKGYYGLKVHKAVIASGARYSGPTVHFVDEHYDTGRTLAQR 233
168041124 148 -GVEYILLAGYLRLLPSELVHAYPRAILNIHPALLPSFGGKGYFGMKVHEAVIRSGARFTGATVHFVDEKYDTGPILAQR 226
145348112  80 hGAEFVLLAGYLRLIPPELCRAYENRMVNIHPALLPAFGGKGMHGENVHKAVVASGARFTGPTIHFVNEAFDEGKILAQT 159
242075832 161 -SVDFVLLAGYLKLIPAELVQEYPKSILNIHPSLLPAFGGKGFYGSKVHKAVIASGARYSGPTVHFVDEHYDTGKTLAQR 239
225469646 165 -EVDFILLAGYLKLIPVELIRAYPKSILNIHPSLLPAFGGKGYYGMKVHKAVIASGARYSSPTVHFVDEHYDTGRILAQR 243
255072241 127 -GVGYVLLAGYLRLIPPQLCRAYEDKMLNIHPALLPAFGGKGMHGHHVHEAVVASGVRFTGPTVHFVNEEFDKGKIVAQR 205
302763025  81 -RVDFVLLAGYLKLIPKELVEAFPRAILNIHPALLPAFGGKGFYGIKVHEAVIASGARVSGPTIHFVDEKYDHGSILAQR 159
302809645  81 -RVDFVLLAGYLKLIPKELVEAFPRAILNIHPALLPAFGGKGFYGIKVHEAVIASGARVSGPTIHFVDEKYDHGSILAQR 159
302849794 168 hQADFVLLAGYLKLIPGELCRAFPRAMLNIHPGLLPSFGGKGYYGERVHKAVIASGARFSGPTVHFVDEQFDTGPILAQR 247
159471718 161 VVPVFPTDTPKQLAARVLKEEHAVYPHCVAALCDGRIGWRE-DGIPILWEAK 211
115477130 234 VVPVLANDTPEQLAARVLHEEHQVYVEAVAALCDDRIVWRE-DGVPLIRSHT 284
168041124 227 VVPVRADDTPAELASRVLKEEHQLYSFAVSALCEDRIFWRE-DGVPIIRKSW 277
145348112 160 VVPVFDDDDASAVAARVLAQEHILFPRVVAAMCEDRIRFRS-DGVPFI---- 206
242075832 240 VVPVFADDTPELLAARVLHEEHQVYVEAVAALCEDRVVWRE-DGVPLIRSPI 290
225469646 244 VVPVLADDTADELAARVLHEEHRLYVEVTSAICDERIVWRE-DGVPIIQSKE 294
255072241 206 HVRVAPSDTPDDVAANVLRLEHEVFSHVVSALVDGRIRFRDgDGVPVIVGED 257
302763025 160 TVPVLETDTPQDLAARVLEQEHALYVEAVAALCEERIEWSG-DGVPRMREKE 210
302809645 160 TVPVLETDTPQDLAARVLEQEHALYVEAVAALCEERIEWSG-DGVPRMREKE 210
302849794 248 VVPVFPTDTPKQLAARVLKEEHQVYPVCVAALCDGRIGWRE-DGIPILWEAK 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap