Conserved Protein Domain Family
PLN02324

?
PLN02324: PLN02324 
triacylglycerol lipase
Statistics
?
PSSM-Id: 177958
View PSSM: PLN02324
Aligned: 3 rows
Threshold Bit Score: 772.65
Threshold Setting Gi: 297848894
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15221426    1 MVEGIPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKNRLLARTGFLKANPFRY 80 
240254556   1 MVGDIATRWKELSGSSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKEELFARTGYLKANPFRY 80 
297848894   1 MVEGIPKRWKVLSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSKYAGDCYYSKNQLFARTGFLKANPFRY 80 
15221426   81 KVTKYIYATASIKLPISFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAIS 160
240254556  81 EVTKYIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAVATDEGKKLLGRRGIVVAWRGTIQLYEWANDFDFPLESAVM 160
297848894  81 NVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAIS 160
15221426  161 VFPVTDPKDNPRIGSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSAADLVYGK 240
240254556 161 VFPGANPNDEPRVANGWLSLYTSTDPRSRFDKTSAQEQVQEELKRLLELYKNEDVTITLTGHSLGAVMSILSAADFLHNE 240
297848894 161 VFPVTDPKDNPRIGSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKNEEISITFTGHSLGAVMSVLSAADLVYGK 240
15221426  241 KNNININLQkKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAPHYPLLLYSEIGEVLEINTLNSTYLKRS 320
240254556 241 WPKITPSLQ-HSLCVTVFAFGSPQIGDRSFKRLVESLEHLHILRVTNVPDLIPRYPVFRFTDIGEELQINTLKSEYLKRS 319
297848894 241 KNKVNISLQkKQVPITVFAFGSPRIGDHNFKNIVDSLQPLNILRIVNVPDVAPHYPLLLYAEIGEVLEINTLNSTYLKRS 320
15221426  321 LNFRNYHNLEIYLHGMAGMQDTDGVFKLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMLQMDDGTWKLDVHRRDHD 400
240254556 320 LNLGHFHNLEAYLHGVAGTQHNQGEFKLEINRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKLNGDRSKKK 399
297848894 321 LNFRNYHNLETYLHGIAGMQDTAGS-------------------------PRNYA------------------------- 350
15221426  401 DDVDADDNDDSSTSN 415
240254556 400 QEEEDEKEENNCKFP 414
297848894     ---------------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap