Conserved Protein Domain Family
PLN02322

?
PLN02322: PLN02322 
acyl-CoA thioesterase
Statistics
?
PSSM-Id: 177956
View PSSM: PLN02322
Aligned: 3 rows
Threshold Bit Score: 284.648
Threshold Setting Gi: 224110296
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224110296   1 SSSSNKERLDVALHSFGFEFGEMSPQRVTGRLLVNPMCVQPFKVLHGGISALISESMASLGAHLASGLQRVAGIQLSINH 80 
15221148    3 SASSNTKAIDPPLHMLGFEFDELSPTRITGRLPVSPVCCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGIQLSINH 82 
297852450   3 SASSKTKAIDPPLHMLGFEFDELSPTRVTGRLPVSPTCCQPFKVLHGGVSALIAESLASTGAHMASGFKRVAGIQLSINH 82 
224110296  81 VKSAHVGDLIVAEATPSSIGKTIQVWDVRIWKLSDpsNTESSKSLVSSSRVTLICNLPVPDHAKEAVENLRSQAKL 156
15221148   83 LKSADLGDLVFAEATPVSTGKTIQVWEVKLWKTTQ--KDKANKILISSSRVTLICNLPIPDNAKDAANMLKMVAKL 156
297852450  83 LKSADLGDLVFAEATPVSTGKTIQVWEVKLWKTTE--KDKANKILISSSRVTLICNLPIPDNAKDAANMLRMIAKL 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap