Conserved Protein Domain Family
PLN02320

?
PLN02320: PLN02320 
seryl-tRNA synthetase
Statistics
?
PSSM-Id: 177954
View PSSM: PLN02320
Aligned: 7 rows
Threshold Bit Score: 945.895
Threshold Setting Gi: 115486243
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242069129   4 CGRFISSSAATSTASFSPFRT----LTRSLLRRPAPRLLSSASAAAAAATAVEPDTKGGGGAggaaaaVRPQWKAAIDFK 79 
115486243   4 CGRFLSSSAAASTPSLSPFRN----LTLSLLRRPHLRLLSSSATASAAAAAVEPDTKGGAGGg----aAKPQWKAAIDFK 75 
30682484   17 SSRL-FLKPFTNTLTLGLFSR--------HLQPRNKPLLVRAFSASAAVQDIPATQTSDSSVa-----ARPLWKAAIDFK 82 
15221121   17 SSRL-FLKPFTNTLTLGLFSR--------HLQPRNKPLLVRAFSASAAVQDIPATQTSDSS-------ARPLWKAAIDFK 80 
224063277  23 SSRF-ILKPISKTLVLNPFSRh---NYVICPQRNPFKLLVRALSAT-AVQTAPITESLDNKV------VKPQWKAAIDFK 91 
255545800  12 SSRFIFMKPVSKTLNLNPISRrfinNKVSYSERPFFTLITRALSATAAVQEPLTTESVDSKV------VKPQWKASIDFK 85 
297844038  16 SSRLFFLKPFPNTLTLGLFSR---------HLQPHKPLLVRAFSASAAVEDIPATQASDSS-------ARPQWKAAIDFK 79 
242069129  80 WIRDNRDAVADNIRSRNSTANLDLVLELYDQYLALQKEVERLRAERNAVANKMKGKLDPSVRQALVEEGKNLKEGLIALE 159
115486243  76 WIRENTDAVAANIRDRNSAANLDLVLQLYDEYLALQKEVERLRAERNAVANKMKGKLEPSVRQALVEEGKNLKEGLIALE 155
30682484   83 WIRDNKEAVEINIRNRNSNANLEAVLQLYENMVNLQKEVERLREERNNVAKKMKGKLEPSERERLVEEGKNLKESLVTLE 162
15221121   81 WIRDNKEAVEINIRNRNSNANLEAVLQLYENMVNLQKEVERLREERNNVAKKMKGKLEPSERERLVEEGKNLKESLVTLE 160
224063277  92 WIRDNKDAVALNIKNRNSNANLELVLELYEKMLAVQKEVERLRAERNAVANKMKGKVEISERQKLIEEGKNLKEGLATLE 171
255545800  86 WIRDNKEEVALNIKNRNSNANLELVLELYEKMLAVQKEVERLRGERNAVANKMKGKLEPSERSKLIDEGKNLKEGLMTLE 165
297844038  80 WIRDNKEAVEINIKNRNSNANLEAVLELYENMVNLQKEVEQLREERNNVAKKMKGKLEPSQRETLVEEGKNLKESLVTLE 159
242069129 160 EDLVQLTDKLQLEAQSIPNTTHPDVPVGGEESSVLRKEVGSQRSFNFTIKDHLQLGKELDLFDFDAAAEVSGSKFYYLKN 239
115486243 156 EDLVQLTDKLQLEAQSIPNTTHPDAPVGGEESSVVRKEVGSQRNFNFTIRDHLQLGKELDLFDFDAAAEVSGSKFYYLKN 235
30682484  163 EDLVKLKDELQHVAQSIPNMTHPDVPVGGEDSSAIRQEVGSPREFSFPIKDHLQLGKDLDLIDFDSAAEVSGSKFFYLKN 242
15221121  161 EDLVKLKDELQHVAQSIPNMTHPDVPVGGEDSSAIRQEVGSPREFSFPIKDHLQLGKDLDLIDFDSAAEVSGSKFFYLKN 240
224063277 172 EDLVKLTDELQLEAQCIPNLTHPLVPIGGEDSSTVRKMAGTPRDFGFPVRDHLQLGKELDLFDFDAAAEVSGSKFYYLKN 251
255545800 166 EDMLKLTDELQQEAQCIPNMTHPAVPIGVEDCSTVRKMVGSPREFSFPVKDHLQLGKELDLFDFDAAAEVSGSKFYYLKN 245
297844038 160 EDLVKLKDELQHVAQSIPNMTHPDVPVGGEDSSAIRKEVGSPREFSFPIKDHLQLGKDLDLIDFDSAAEVSGSKFFYLKN 239
242069129 240 EAVLLEMALVNWAISEVSKKGFTPLITPEIVRSSVVEKCGFQPRAQNTQVYSIEDSDQCLIGTAEIPVGGIHMDSILAES 319
115486243 236 EAVLLEMALVNWAITEVSKKGFTPLITPEIVRSSVVEKCGFQPRAQNTQVYSIDNSDQCLIGTAEIPVGGIHMDSILPDS 315
30682484  243 EAVLLEMALLNWTLSQVMKKGYTPLTTPEIVRSSIVEKCGFQPRGDNTQVYSIDGTDQCLIGTAEIPVGGIHMDSILLES 322
15221121  241 EAVLLEMALLNWTLSQVMKKGYTPLTTPEIVRSSIVEKCGFQPRGDNTQVYSIDGTDQCLIGTAEIPVGGIHMDSILLES 320
224063277 252 EAVMLEMALVNWTLSEVMKKGFTPLTTPELVRSSVVEKCGFQPRGDNTQVYSIEGSDQCLIGTAEIPVGGIHMDAILAET 331
255545800 246 EAVMLEMALVNWTLSEVMKRGFTPLTTPELVRASVVEKCGFQPRGDNTQVYSIEGSDQCLIGTAEIPVGGIHMESILTAS 325
297844038 240 EAVLLEMALLNWTLSQVMKQGFTPLTTPEIVRSAIVEKCGFQPRGDNTQVYSIDGTDQCLIGTAEIPVGGIHMDSILLES 319
242069129 320 ALPLKYVAYSHCFRTEAGAAGAATRGLYRVHQFSKVEMFIFCRPDESDKLHEELITIEEDLYASLGLHFKTLDMATGDLG 399
115486243 316 DLPRKYVAYSHCFRTEAGAAGAATRGLYRVHQFSKVEMFVFCRPEESDKCHEELITIEEELYASLGLHFKTLDMATGDLG 395
30682484  323 ALPLKYIAFSHCFRTEAGAAGAATKGLYRVHQFSKAEMFVICQPEDSESFHQELIQIEEDLFTSLGLHFKTLDMATADLG 402
15221121  321 ALPLKYIAFSHCFRTEAGAAGAATKGLYRVHQFSKAEMFVICQPEDSESFHQELIQIEEDLFTSLGLHFKTLDMATADLG 400
224063277 332 QLPLKYVAYSHCFRTEAGAAGTATRGLYRVHQFTKVEMFVLCRPEESDSYHEELIKIEEDLFSALGLHYKTLDMASGDLG 411
255545800 326 MLPLKYVAFSHCFRTEAGAAGTATRGLYRVHQFSKVEMFILCPAEESESHHEELIKIEEDLFSSLGLHFKTIDMASADLG 405
297844038 320 VLPLKYIAFSHCFRTEAGAAGAATKGLYRVHQFNKAEMFVICRPEDSESFHQELIQIEEDLFTSLGLHFKTLDMATADLG 399
242069129 400 APAYRKFDIEAWMPGLERYGEISSASNCTDYQSRRLGIRYRPSpsEPPSTNTKKGKGAgSGPTQFVHTLNATAVAVPRLI 479
115486243 396 APAYRKFDIEAWMPGLDRYGEISSASNCTDYQSRRLGIRFRPSpaDPPPANAKKGKGS-SGPTQFVHTLNATAVAVPRLI 474
30682484  403 APAYRKFDIEAWMPGLGRFGEISSASNCTDYQSRRLGIRYRPS--EPPQTGPKKGKAN-LPATKFVHTLNATACAVPRMM 479
15221121  401 APAYRKFDIEAWMPGLGRFGEISSASNCTDYQSRRLGIRYRPS--EPPQTGPKKGKAN-LPATKFVHTLNATACAVPRMM 477
224063277 412 APAYRKFDVEAWMPGLGRYGEISSASNCIDYQSRRLGIRYRPS--EPTPAPPKKGKGS-LAPTQFVHTLNATACAVPRMI 488
255545800 406 APAYRKFDVEAWMPGLGRYGEISSASNCTDYQSRRLGIRYRPS--DPTLRNPKKGKSS-LGPTKFVHTLNATACAVPRML 482
297844038 400 APAYRKFDVEAWMPGLGRFGEISSASNCTDYQSRRLGIRYRPS--EPPQTGPKKGKAN-LPATKFVHTLNATACAIPRMM 476
242069129 480 VCILENFQQDDGSIVVPEPLRPYMGGLEVISPKFE 514
115486243 475 ICILENFQQEDGTVVIPEPLRPFMGGLEVLSPKTK 509
30682484  480 VCLLENYQQEDGSVVIPEPLRPFMGGIELIKPKHK 514
15221121  478 VCLLENYQQEDGSVVIPEPLRPFMGGIELIKPKHK 512
224063277 489 VCLLENYQQEDGSVIIPGPLRAFMGGLELITPKST 523
255545800 483 ICLLENYQQEDGSVIIPEPLRPFMGGLELIAPKSS 517
297844038 477 VCLLENYQQEDGAVVIPEPLRPFMGGIELIKPKLK 511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap