Conserved Protein Domain Family
PLN02318

?
PLN02318: PLN02318 
phosphoribulokinase/uridine kinase
Statistics
?
PSSM-Id: 177952
View PSSM: PLN02318
Aligned: 20 rows
Threshold Bit Score: 808.7
Threshold Setting Gi: 302836750
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225425041   1 MAQDTSG--AESPQPRPGLLKDQVRLVRRK-N---SDRYEIVPIQDRLSFEKGFFIVIRACQLLAQNNDGI-ILVGLAGP 73 
15221102    1 MALDSSV--ALSPRRRHGLLRDQVQLIKRK-D---SGRYEIVPIEDPLSFEKGFYAVIRACQLLAQKNDGL-ILVGLAGP 73 
242066250   1 MDQHDSM--ADSPRRRHNLLRDKVQLVKRK-D---SNRYEIVRFHDPLSFEKGFFVVIRACQLLAQHNDGI-IFVGVAGP 73 
242052611   1 MDQHDSM--ADSPRRLHNLLRDKVQLVKRK-D---SNRYEIVRFRDPLSFEKGFFVVIRACQLLAQHNGGI-IFVGVAGP 73 
302782940   1 -----MRklLPSPHRRTGLLKDQLQLVPRKgDggrEDRYEIAPISDPLSFDKGFFLFIRACQLLTRKMEGVtIVVGVAGP 75 
302782942   1 -----MRklLPSPHRRTGLLKDQLQLVPRKgDggrEDRYEIAPISDPLSFDKGFFLFIRACQLLTRKMEGVtIVVGVAGP 75 
302763009   1 --------mSASHRRKCGLLKHQLRLVRRK-D---CDRYEVAPIADSLSFEKGFFLFIRACQLLAQNMEGV-ILVGLAGP 67 
302823981   1 -----MRklLPSPHRRTGLLKDQLQLVPRKgDggrEDRYEIAPISDPLSFDKGFFLFIRACQLLTRTMEGVtIVVGVAGP 75 
302809629   1 --------mSASHRRKCGLLKHQLCLVRRK-D---CDRYEVAPIADSLSFEKGFFLFIRACQLLAQNMEGV-ILVGLAGP 67 
297842147   1 MVLDSSV--ALSPRRRHGLLRDQVQLIKRK-D---SGRYEIVPIEDPLSFEKGFYAVIRACQLLAQKNDGL-ILVGLAGP 73 
225425041  74 SGAGKTVFTEKILNFMPSIAVISMDNYNDASRIVDGNFDDPRLTDYDTLLQNVHDLKAGKQVQIPIYDFKSSSRTGYRTL 153
15221102   74 SGAGKTIFTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTL 153
242066250  74 SGAGKTVFTEKVVNFMPDVAVISMDNYNDATRIVDGNFDDPRLTDYDTLLENIHGLKEGRSVQVPIYDFKSSCRTGYRTV 153
242052611  74 SGAGKTVFTEKVVNFMPDVAVISMDNYNDATRIVDGNFDDPRLTDYDTLLENIHGLKEGRSVQVPIYDFKSSCRIGYRTV 153
302782940  76 SGAGKTVFTDKVASFLPGIAIICMDNYNDSSLVIDGNYDDPRIVDYEILLDNIKSLRAGNSADIPIYDFKLSRRVGYRRL 155
302782942  76 SGAGKTVFTDKVASFLPGIAIICMDNYNDSSLVIDGNYDDPRIVDYEILLDNIKSLRAGNSADIPIYDFKLSRRVGYRRL 155
302763009  68 SGAGKTVFSEKVGSFMPGIGTISMDNYNDSSRVIDGNYDDPRLTDYDTLLDNLQNLRAGNSVEVPIYDFKISKRVGYRKL 147
302823981  76 SGAGKTVFTDKVASFLPGIAIICMDNYNDSSLVIDGNYDDPRIVDYEILLDNIKSLRAGTSADIPIYDFKLSRRVGYRRL 155
302809629  68 SGAGKTVFSEKVGSFMPGIGTISMDNYNDSSRVIDGNYDDPRLTDYDTLLDNLQNLRAGNSVEVPIYDFKISKRVGYRKL 147
297842147  74 SGAGKTIFTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTL 153
225425041 154 EVPSSRIVIIEGIHALSEKMRPLLDLRVSVTGGIHFDLVKRVLRDIQRAGQEPEEIIQQISETVYPMYKAFIEPDLGTAH 233
15221102  154 EVPSSRIVILEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLKTAQ 233
242066250 154 DVPSSRIVIIEGIYALSEKLRPVMDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLETAH 233
242052611 154 DVPSSRIVIIEGIYALSEKLRPVMDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLETAH 233
302782940 156 EHPSTRIVIVEGIYALCEKLRPFLDLRVSITGGVHFDLVKRVLRDINRSGQAPEDIIHQISETVYPMYKVFIEPDLATAH 235
302782942 156 EHPSTRIVIVEGIYALCEKLRPFLDLRVSITGGVHFDLVKRVLRDINRSGQAPEDIIHQISETVYPMYKVFIEPDLATAH 235
302763009 148 DVPSSRIVIVEGIYALSEKLRPLLDLRVSITGGVHFDLVKRVLRDINRSGQEPEDIIHQISETVYPMYKAFIEPDLETAH 227
302823981 156 EHPSTRIVIVEGIYALCEKLRPFLDLRVSITGGVHFDLVKRVLRDINRSGQAPEDIIHQISETVYPMYKVFIEPDLATAH 235
302809629 148 DVPSSRIVIVEGIYALSEKLRPLLDLRVSITGGVHFDLVKRVLRDINRSGQEPEDIIHQISETVYPMYKAFIEPDLETAH 227
297842147 154 EVPSSRIVILEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLKTAQ 233
225425041 234 IKITNKFNPFTGFQSPTYILKSARNVTVDQIKAVITEEHAETMEEVYDIYLLPPGEDPESCQSYLRMRNKDGKYSLMFEE 313
15221102  234 IKILNKFNPFSGFQNPTYILKSSKAVTPEQMKAALSEDFKERTEETYDIYLLPPGEDPEACQSYLRMRNRDGKYNLMFEE 313
242066250 234 IKIINKFNPFSGFQNPMYILKSPRSLAPEKIKAVLGDDHTESNEETYDIYLLPPGEDPEACQSYLRMRNREGKYNLMFEE 313
242052611 234 IKIVNKFNPFSGFQNPMYILKSPRSLLPEKIKSVLGDDHMESNEETYDIYLLPPGEDPEACQSYLRMRNREGKYNLMFEE 313
302782940 236 IKVVNKFNPFLGFQSPTYILTSSRHVTEEEIKAAIGSKFTEATEDTYDIYLLPPGEDLETCQSYLRMRNRDGRYSLIFEE 315
302782942 236 IKVVNKFNPFSGFQSPTYILKSSRHVTEEEIKAAIGSKFTEATEDTYDIYLLPPGEDPETCQSYLRMRNRDGRYSLIFEE 315
302763009 228 IKIVNKFNPFSGFQNATYILKSSRSVTEEQIRNVLSNDHTETIEEIYDIYLLPPGEDPETCQSYLRMRNRDGKYSLMFEE 307
302823981 236 IKVVNKFNPFSGFQSPTYILKSSRHVTEEEIKAVIGSKFTEATEDTYDIYLLPPGEDPETCQSYLRMRNRDGRYSLIFEE 315
302809629 228 IKIVNKFNPFSGFQNATYILKSSRSVTEEQIRNVLSNDHTETIEEIYDIYLLPPGEDPETCQSYLRMRNRDGKYSLMFEE 307
297842147 234 IKILNKFNPFSGFQNPTYILKSTKAVTPEQVKAALSEDFKERTEETYDIYLLPPGEDPEACQSYLRMRNRDGKYNLMFEE 313
225425041 314 WVTDNPFVISPRITFEVSVRLLGGLMALGYTIATILKRNSHAFSD--DRVCVKIDWLEQLNRQYIQVQGKDRLVVKCVGE 391
15221102  314 WVTDRPFIISPRITFEVSVRLLGGLMALGYTIATILKRKSHIFDD--DKVIVKTDWLEQLNRTYVQVQGKDRTFVKNVAD 391
242066250 314 WVTDNPFIISPRITFEVSVRLLGGLMALGYTIAAILKRSSRVFSD--GKATVKIDWLEQLNRQYIQVQGRDRLYVKFVAD 391
242052611 314 WVTDNSFIISPRITFEVGVRLLGGLMALGYTIAAILKRSSRVFSD--GKATVKIDWLEQLNRHYIQVQGRDRLYVKFVAD 391
302782940 316 LVTDEDFIISPRITFDVSVRLLGGLMALGYEMATIMKRSSRVFCDetEKIVVKIDKLEQVQRKYVQIQGKDRSLVADIGK 395
302782942 316 LVTDEDFIISPRITFDVSVRLLGGLMALGYEMATIMKRSSRVFCDetEKIVVKIDKLEQVQRKYVQIQGKDRSLVADIGK 395
302763009 308 WVIDEPFIISPRITFEVSVRLLGGLMALGYEMATILKRISHVFSD--EKVTVKLDRLEQFQRKYVQVQGKERSVVSDCGS 385
302823981 316 LVTDEDFIISPRITFDVSVRLLGGLMALGYEMATIMKRSSRVFCDetEKIVVKIDKLEQVQRKYVQIQGKDRSLVADIGK 395
302809629 308 WVIDEPFIISPRITFEVSVRLLGGLMALGYEMATILKRISHVFSD--EKVTVKLDRLEQFQRKYVQVQGKERSVVSDCGS 385
297842147 314 WVTDRPFIISPRITFEVSVRLLGGLMALGYTIASILKRKSHIFDG--DKVIVKTDWLEQLNRTYVQVQGKDRTFVKNVAD 391
225425041 392 QLQLEGSYSPRTYIEQIQLEKLVNEVMALPDDLKTKLSIDEDMV--SSPKEALSRFSADSvamRNKHFKSGMSHSYSTHR 469
15221102  392 QLGLEGSYVPHTYIEQIQLERLVNDVLALPDDLKTKLSLDDDTV--SSPKEALSRASVDS---RMKYLHGGVSKSYTNPR 466
242066250 392 QLGLDGSYIPRTYIEQIQLEKLINDVMALPEDLKTKLSIDDELV--SSPKEAFSRVSADR---RNKLIKSGLSQSYSTHG 466
242052611 392 QLGLDGSYIPRTYIEQIQLEKLINDVMALPEDLKTKLSIDDELV--SSPKEAFSRVSADR---RNKLMKSGLSQSYSTHR 466
302782940 396 KLGLEGSYIPRSYIEQIQLEKLTAEVVALPEDLKNKLSLQTTTV----PESPVSSKTYSR-------------------- 451
302782942 396 KLGLEGSYIPRSYIEQIQLEKLTAEVVALPEDLKNKLSLKTTTVpgSPVSS----------------------------- 446
302763009 386 KLGLDNHYVPCSYIEQIQLEKLNSE-MALPEDLKEKLSNDTLL---PSPTPSFSWLAETKpgiLFR--REPLFMSRKGHN 459
302823981 396 KLGLEGSYIPRSYIEQIQLEKLTAEVVALPEDLKNKLSLQTTTVpgSPV--------------SSKTYSRSLSWNTSSLR 461
302809629 386 KLGLDNHYVPCSYIEQIQLEKLNSE-MALPEDLKEKLSNDTLL---PSPTPSFSWLAETKpgiLFR--REPLFMSRKGHN 459
297842147 392 QLGLEGSYVPHTYIEQIQLERLVNDVLALPDDLKTKLSLDDDTV--SSPKEALSRASVDS---RMKYLHGGVSKSYTNPR 466
225425041 470 DKNLSNHTGFSVSN--RKFDDRPTELPAMLaNKGAITQLSEQISSLNDRMDEFTSQIEELNSKLTMK-KVSASQQNLAFQ 546
15221102  467 HKVLPNLTRLAVNN--RMLDARAPASPATLpNQGFITQLSDQISTLNERMDEFTSRIEELNSKIPNRiAPSGSQHNLALP 544
242066250 467 DKNIVKLSNLTDTN--RRFGAGRTLEPPAI-NQGAITQLSEQISTLNERMDEFTSRVEELNSKFMAK-KHLPSQQNLALP 542
242052611 467 DKRVVKLSQL--TE--RRFGGGQALEPPAI-DQGGIIQLSEQISTLNERMDEFTSRVEELNSKFSVK-KHLPSQQNLALP 540
302782940 452 --------------------------------------------SLSWNTSRFV-------------------------- 461
302782942 447 -------------------------------------------KTYSRRYEEILVFPSSKTFFFSTA------------- 470
302763009 460 GKKSQHLWIEANGK--KEEPEPQSHIVDDQvTECLTIRVSEQMASINERLDEVLSRLVELESKLPAAvTTSVSIQRQNSA 537
302823981 462 KQPERKPPPLKIENlqRIQDDRGSESPL---TDQVYPRVVEQLANVNEKLDELVSRLAELEKKLITP------------- 525
302809629 460 GKKSQHLWIEANGK--KEEPEPQSHIVDDQvTECLTIRVSEQMASINERLDEVLSRLVELESKLPAAvTTSVSIQRQNSA 537
297842147 467 HKALPNLTRLAVNN--RMLDARAPASPATLpNQGFITQLSDQISTLNERMDEFTSRIEELNSKIPNRiAASGSQHNLALP 544
225425041 547 AEANNGSAPT-FFIPGIGNGSLtgtmMHKSSSSSQLAKELPLMEEILGIARSQRQVMHQLDNISSLVREDIgGGRSe--- 622
15221102  545 IENGNGSV------------------LSFSASASQLVRESPLMEEVVLVARGQRQIMHQMDTLSNLLREYV-GEKTrier 605
242066250 543 NDACNGSTPTnLFVSQLGNGTL----IPHSSSSNQLAKDSPMIEEIMNISRGQRQVIHQLDNLTNLLHEHLvLTRQ---- 614
242052611 541 NDACSGSTPTnLFVSQLGNGTL----IPHSSSSNQLSKDSPMIEEVMNISRGQRQVIHQLDNLTNLLHEHLvLTRQ---- 612
302782940 462 ---------------------------------------------ILFFFRSPKHSIH---------------------- 474
302782942     --------------------------------------------------------------------------------    
302763009 538 FVGSFGSNGPsAFLANGNANGHsspsVPLLQSSS----EAYILEEIKILSRGQRHLANQLDMLSNLMHEKYsSSKKk--- 610
302823981 526 --------------------SSavpiITPRRVSSGSNDEQVLSNEVRSLARGQHDMNTQLDLLTNFIRQRQ--------- 576
302809629 538 FVGSFGSNGPsAFLANGNANGHsspsVPLLQSSS----EAYILEEIKILSRGQRHLANQLDMLSNLMHEKYsSSKKk--- 610
297842147 545 IENGNGSV------------------LSLSSSASQLVRESPLMEEVILIARGQRQIMLQMDTLSNLLREYV-GERSrier 605
225425041 623 gGRRERKSIMLDIEPTRVPLIlALAVGGLGIFLFKAFLPR 662
15221102  606 lDSSRTNSTTQNLESSTVPILlGLAIGCVGIFAYSRLK-- 643
242066250 615 -ANNASRNRVLDIDTVMCPLI-CLTVASIGYFMFKGLNRG 652
242052611 613 --------------ANSCPLI-CLTVASIGYFMFKGLNRS 637
302782940     ----------------------------------------    
302782942     ----------------------------------------    
302763009 611 sAKARFKAALRNMRTSSAGLA-SAAAAAMGLTTLAAVVVV 649
302823981 577 -LLPIEQGGLSLYPNPKFFLVgSLAFIACSWFLVNARKA- 614
302809629 611 sAKARFKAALRNMRTSSAGLA-SAAAAAMGLTTLAAVVVV 649
297842147 606 lDSNRTNSKTQNLESSTVPILlGLGIGCVGIFAYSRLK-- 643
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap