Conserved Protein Domain Family
PLN02315

?
PLN02315: PLN02315 
aldehyde dehydrogenase family 7 member
Statistics
?
PSSM-Id: 177949
View PSSM: PLN02315
Aligned: 11 rows
Threshold Bit Score: 985.482
Threshold Setting Gi: 302755498
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302766826   2 DFGSRPELRFLEDLGLQATNQGCYGGGEWRAGGKSVSSLSPASNQ-PIATVIEGSLEDYERSLKACESARESWML----- 75 
15221042    1 MGSANNEYEFLSEIGLTSHNLGSYVAGKWQANGPLVSTLNPANNQ-PIAQVVEASLEDYEQGLKACEEAAKIWMQ----- 74 
30695661    1 MGSANNEYEFLSEIGLTSHNLGSYVAGKWQANGPLVSTLNPANNQ-PIAQVVEASLEDYEQGLKACEEAAKIWMQ----- 74 
115479375   2 GSFARKEHQFLAELGLAPRNPGSFACGAWGGSGPVVTSTNPTNNQ-VIAEVVEASAREYEEGMRACYDAAKTWMA----- 75 
168051821   3 VEFEREDYLFLNELGISPENLGCYGGGVWRANGPTVTSVNPSDNK-PIASVREASLEDYEDSMRACAEARRMWML----- 76 
224073640   1 MGFARKEYEFLSEIGLSSRNLGCYVDGTWKANGPVVTSVNPANNQvAIAEVVEGSIEDYEEGMRACSEAAKIWMQaslff 80 
224119508   1 MSFARKEYEFLSEIGLSSRNLGCYVDGTWKANGPVVTSVNPANNQ-AIAEVVEGSVEDYEEGMRACSEAAKIWMQ----- 74 
225444704   1 MSFERKEYQFLAEIGVGPANPGCYINGEWKARGPLVSSVNPSNNQ-RIAVVTEASIEDYEEGLMACSEAAKTWMK----- 74 
242049414   2 GAFAKEEHQFLAELGLAQRNPGAFVCGAWGGSGPAVTSTSPTNNQ-VIAEVVEASVQDYEEGMRACFDAAKTWMA----- 75 
297853194   1 MGSANNEYEFLSEIGLTSHNLGSYVAGKWQANGPLVSTFNPANNQ-PIAQVVEASLEDYEQGLKACEEAAKIWMQ----- 74 
302755498   2 DFGSRPELRFLEDLGLQATNQGCYGGGEWRAGGKSVSSLSPASNQ-PIATVIEGSLEDYERSLKACESARESWML----- 75 
302766826  76 --TPAPKRGEIVRQIGDAFRKNLENLGRLISLEMGKILVEGIGEVQEVIDMCDFAVGLSRQLSGLILPSERPNHMMMEVW 153
15221042   75 --VTAPKRGDIVRQIGDALRSKLDYLGRLLSLEMGKILAEGIGEVQEVIDMCDFAVGLSRQLNGSVIPSERPNHMMLEMW 152
30695661   75 --VTAPKRGDIVRQIGDALRSKLDYLGRLLSLEMGKILAEGIGEVQEVIDMCDFAVGLSRQLNGSVIPSERPNHMMLEMW 152
115479375  76 --IPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQEIIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVW 153
168051821  77 --TPAPKRGEIVRQIGDGLRDKLPLLGKLVSLEMGKILAEGIGEVQEFIDMCDYAVGLSRQLSGSIIPSERPNHAMMEVW 154
224073640  81 laVPSPKRGEIVRQIGDALRTKLQQLGRLVSLEMGKILPEGIGEVQEIIDMCDFSVGLSRQLNGSVIPSERPNHAMLEMW 160
224119508  75 --VPSPKRGEIVRQIGDALRTKLQELGRLVSLEMGKILPEGIGEVQEIIDMCDFCVGLSRQLNGSVIPSERPNHAMLEMW 152
225444704  75 --IPAPKRGEIVRQIGEALRAKLGSLGRLVSLEMGKILAEGIGEVQEIVDMCDYAVGLSRQINGSIIPSERPDHMMCEVW 152
242049414  76 --FPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQEIIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVW 153
297853194  75 --VTAPKRGDIVRQIGDALRSKLDYLGRLLSLEMGKILAEGIGEVQEVIDMCDFAVGLSRQLNGSVIPSERPNHMMLEMW 152
302755498  76 --TPAPKRGEIVRQIGDAFRKNLENLGRLISLEMGKILVEGIGEVQEVIDMCDFAVGLSRQLSGLILPSERPNHMMMEVW 153
302766826 154 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLVSIATTKIIAGVLERNGLPGAIFTCICGGAEIGEAVA 233
15221042  153 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKLVAEVLEKNNLPGAIFTAMCGGAEIGEAIA 232
30695661  153 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKLVAEVLEKNNLPGAIFTAMCGGAEIGEAIA 232
115479375 154 NPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVASVLERNNLPGSIFTAFCGGADIGQAIS 233
168051821 155 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLVTLATTKVIAEVLERNKLPGGIFTCVCGGAEIGSAIA 234
224073640 161 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTRLVAGVLEKNNLPPAIFTSFCGGADIGQAVA 240
224119508 153 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTRLVAGVLEKNNLPPAIFTSFCGGADIGQAIA 232
225444704 153 NPMGIVGVITAFNFPCAVLGWNACLALVCGNCVVWKGAPTTPLVTIAVTKLVAEVLEKNNLPGAIFTSFCGGAEIGEAIS 232
242049414 154 NPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKIVASVLEKNNLPGAIFTSFCGGTEIGQAIA 233
297853194 153 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKLVAEVLEKNNLPGAIFTAMCGGAEIGEAIA 232
302755498 154 NPLGIVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLVSIATTKIIAGVLERNGLPGAIFTCICGGAEIGEAIA 233
302766826 234 KDSRIPLVSFTGSSKVGQIVQCHVNSRFGKCLLELSGNNAIVVMDDADLSLAVRSVLFAAVGTAGQRCTTCRRLFVHQAI 313
15221042  233 KDTRIPLVSFTGSSRVGSMVQQTVNARSGKTLLELSGNNAIIVMDDADIQLAARSVLFAAVGTAGQRCTTCRRLLLHESV 312
30695661  233 KDTRIPLVSFTGSSRVGSMVQQTVNARSGKTLLELSGNNAIIVMDDADIQLAARSVLFAAVGTAGQRCTTCRRLLLHESV 312
115479375 234 LDTRIPLVSFTGSTKVGLMVQQQVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLLLHESI 313
168051821 235 YDTRIPLVSFTGSTKVGLLVQSIVHARHGKTLLELSGNNAIIVMDDAVLPLAVRAVLFAAVGTAGQRCTTCRRLIVHEKV 314
224073640 241 KDARIPLVSFTGSSKVGLMVQQIVNQRFGKCLLELSGNNAIIVMDDANIQLAVRSVMFAAVGTAGQRCTTCRRLLLHESI 320
224119508 233 KDTRISLVSFTGSSKVGLMLQQTVNQRFGKCLLELSGNNAIIIMDDADIQLAVHSVLFAAVGTAGQRCTTCRRLLLHESI 312
225444704 233 KDARIPLVSFTGSSKVGLMVQQAVNQRFGKCLLELSGNNAIIIMEDADIGLAVRSVLFAAVGTAGQRCTTCRRLLVHESI 312
242049414 234 VDTRIPLVSFTGSTRAGLMVQQQVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLILHESI 313
297853194 233 KDTRIPLVSFTGSSRVGSMVQQTVNARSGKTLLELSGNNAIIVMDDADIQLAARSVLFAAVGTAGQRCTTCRRLLLHESV 312
302755498 234 KDSRIPLVSFTGSSKVGQIVQCHVNSRFGKCLLELSGNNAIVVMDDADLSLAVRSVLFAAVGTAGQRCTTCRRLFVHQAI 313
302766826 314 YKDFIEKLVTAYGQLKVGDPLKHDTLVGPLHSSQSKQAFEQGLEAIASQG-GKFLTGgvGTTTSPGENYVTPSIVEISHD 392
15221042  313 YDKVLEQLLTSYKQVKIGNPLEKGTLLGPLHTPESKKNFEKGIEVIKSQG-GKILTG--GKAVEGEGNFVEPTIIEISAD 389
30695661  313 YDKVLEQLLTSYKQVKIGNPLEKGTLLGPLHTPESKKNFEKGIEVIKSQG-GKILTG--GKAVEGEGNFVEPTIIEISAD 389
115479375 314 YRTFLDQLVEVYKQVRIGDPLENGTLLGPLHTPASRDAFLKGIQTIRSQG-GKILYG--GSAIESEGNFVQPTIVEISPS 390
168051821 315 YDDMLAGLLKAYKQVKTGNAVDETTLCGPLHSKHSKACFEEGIKKIKAQG-GKILTG--GSVIDRDGNFVEPTVVEISHD 391
224073640 321 YQRVLDQLLDVYKQVKIGDPLEKGTLLGPLHTSESRKSFEKGIEIIKSQA-CKIITG--GSVIESEGNFVQPTIVEISPN 397
224119508 313 YQRVLDQLLDVYKQVKIGNPLEKGNLLGPLHTSESRKSFERGIEIIKSQG-GKILIG--GSVIESEGNFVQPTIVEISPN 389
225444704 313 YETVLNQLIDVYKQVKMGDPLEKSTLVGPLHTRASKENFEKGIEIIKFQG-GNILIG--GSTVESEGNFVQPTIVEISPN 389
242049414 314 YQTFLDQLVEVYKQVRIGDPLEKGTLLGPLHTPASKENFLKGVQTIKSQG-GKILFG--GSAIESEGNFVQPTIVEITPS 390
297853194 313 YDKVLEQLLTSYKQVKIGNPLEKGTLLGPLHTPESKRNFEKGIEVIKSQArGKILTG--GKAVEGEGNFVEPTIIEISAD 390
302755498 314 YKDFIEKLVTAYGQLKVGDPLKHDSLVGPLHSSQSKQAFEQGLEAIASQG-GKFLTGgvGTTTSPGENYVTPSIVEISHD 392
302766826 393 ADVVKEELFGPLLYVFQFKTLDEAIAMNNSVPQGLSSSIFTKSHETIFKWIGPTGSDCGIVNVNIPTNGAEIGGAFGGEK 472
15221042  390 AAVVKEELFAPVLYVLKFKSFGEAVAINNSVPQGLSSSIFTRNPENIFRWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEK 469
30695661  390 AAVVKEELFAPVLYVLKFKSFGEAVAINNSVPQGLSSSIFTRNPENIFRWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEK 469
115479375 391 APVVREELFGPVLYVMKVQNLKEAVEINNSVPQGLSSSIFTKRPDIIFKWIGPHGSDCGIVNVNIPTNGAEIGGAFGGEK 470
168051821 392 AEIVREELFGPVLYVFKIKSLEEAIELNNSVPQGLSSSIFTRNPETIFTWIGPTGSDCGIVNVNIPTNGAEIGGAFGGEK 471
224073640 398 ADVVKEELFAPVLYVMKFQTLQEAIEINNSVPQGLSSSIFTRQPGVIFKWIGPQGSDCGIVNVNIPTNGAEIGGAFGGEK 477
224119508 390 ADVVKEELFAPVLYVMKFQTLQEAIEINNSVPQGLSSSIFTRKPEIIFKWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEK 469
225444704 390 ASVVKEELFGPVLYVMKFQTFEEAVEMNNSVPQGLSSSIFTRKPEVIFKWIGPHGSDCGIVNVNIPTNGAEIGGAFGGEK 469
242049414 391 AAVVKEELFGPVLYVMKFQSLKEAIEINNSVPQGLSSSIFTKRPEIIFKWLGPHGSDCGIVNVNIPTNGAEIGGAFGGEK 470
297853194 391 AAVVKEELFGPVLYVLKFKSFEEAVAINNSVPQGLSSSIFTRNPENIFRWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEK 470
302755498 393 ADVVKEELFGPLLYVFQFKTLDEAIAMNNSVPQGLSSSIFTKSHETIFKWIGPTGSDCGIVNVNIPTNGAEIGGAFGGEK 472
302766826 473 ATGGGREAGSDSWKQYMHRATCTINYGKTLPLAQGINFN 511
15221042  470 ATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFG 508
30695661  470 ATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFG 508
115479375 471 ATGGGREAGSDSWKQYMRRATCTINYGSELPLAQGINFG 509
168051821 472 ATGGGREAGSDSWKQYMHRATCTINYGNDLPLAQGINFG 510
224073640 478 ATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFG 516
224119508 470 ATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFG 508
225444704 470 ATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFG 508
242049414 471 ATGGGREAGSDSWKQYMRRATCTINYGSELPLAQGINFG 509
297853194 471 ATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFG 509
302755498 473 ATGGGREAGSDSWKQYMHRATCTINYGKTLPLAQGINFN 511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap