Conserved Protein Domain Family
PLN02308

?
PLN02308: PLN02308 
endoglucanase
Statistics
?
PSSM-Id: 177943
View PSSM: PLN02308
Aligned: 10 rows
Threshold Bit Score: 952.427
Threshold Setting Gi: 115448507
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115448507   9 EAVAVVAAAVLVLLLSPAAVVVVAGQHDYGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAASVDLTGGYYDAG 88 
15223222    1 MARKSLIFPVILLAVLLFSPPIYSAGHDYRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLSGGYYDAG 80 
15220676    1 MAGKSFMTPAIMLAMLLLISPETYAGHDYRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLTGGYYDAG 80 
115467438   1 ----MAAAGGAVLLLVLATATSVTGQHDYSDALHKSILFFEGQRSGRLPPDQRLRWRRDSALNDGATAGVDLTGGYYDAG 76 
224111474   1 ----------FLLLLLLTSRQVIGGGHDYHDALRKSILFFEGQRSGKLPPDQRVKWRRDSALHDGSSVGRDLTGGYYDAG 70 
224099525   8 TSLRNLRVTAVPFLVLLSLHAVIGSGHDYHDALRKSILFFEGQRSGKLPPDQRVKWRRDSALHDGSTVGRDLTGGYYDAG 87 
242066084   6 QSVRAMAAAAAVVAMLLSTAAVAAAQHDYGDALHKCILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAG 85 
255573716   4 KSHTSTFSVAIFLLLLYFLPISCGANHDYHDALRKSILFFEGQRSGKLPPDQRIKWRKDSALHDGASIGRDLTGGYYDAG 83 
297845390   1 MAGNSLIAPAIMLALLLLISPEIYAGHDYRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLTGGYYDAG 80 
297841815   1 MARKSLIFPVILLAVLLFSPPIYSAGHDYRDALRKSILFFEGQRSGKLPPDQRLKWRRDSALRDGSSAGVDLSGGYYDAG 80 
115448507  89 DNVKFGFPMAFTATLMSWGLIDFGRSFGPHKEEARKAVRWATDYLMKATAKPNTVYVQVGDAFRDHSCWERPEDMDTPRT 168
15223222   81 DNIKFGFPMAFTTTMLSWSIIDFGKTMGPELRNAVKAVKWGTDYLLKATAIPGVVFVQVGDAYSDHNCWERPEDMDTLRT 160
15220676   81 DNVKFGFPMAFTTTMMSWSVIDFGKTMGPELENAVKAIKWGTDYLMKATQIPDVVFVQVGDAYSDHNCWERPEDMDTLRT 160
115467438  77 DNVKFGFPMAFTATLMSWGLIDFGRSFGAHAAEAREAVRWATDYLMKATATPNTVYVQVGDAFRDHSCWERPEDMDTPRT 156
224111474  71 DNIKFGFPMAFTTTLLSWSIIDFGRNMGPELKNAVKAVKWATDYLLKVTAVPNVVYVQLGDAYSDHNCWERPEDMDTLRT 150
224099525  88 DNIKFGFPMAFTTTLLSWSIVDFGRNMGPELKNAVKAVKWATDYLLKVTAVPDVVYVQVGDAYSDHNCWERPEDMDTLRS 167
242066084  86 DNVKFGFPMAFTATLMSWGLIDFGRSFGAHREEARKAVRWATDYLMKATARPNTVYVQVGDAFRDHACWERPEDMDTPRT 165
255573716  84 DNIKFGFPMAFTATLLSWSIIDFGRNMGPELKNAVKAVKWVTDYLLKVTAVPGVVYVQVGDAYSDHNCWERPEDMDTLRT 163
297845390  81 DNVKFGFPMAFTTTMMSWSVIDFGKTMGPELENAVKAIKWGTDYLMKATQIPGVVFVQVGDAYSDHNCWERPEDMDTLRT 160
297841815  81 DNIKFGFPMAFTTTMLSWSIIDFGKTMGPELKNAVKAVKWGTDYLLKATAIPGVVFVQVGDAYSDHNCWERPEDMDTLRT 160
115448507 169 VYKVDPSHPGSDVAAETAAALAAGSIVFRDADPAYSKRLLDRAIAVFEFADKYRGPYSSSLHDAVCPCYCDFSGYKDELL 248
15223222  161 VYKIDRAHPGSDVAGETAAALAAASIVFRKRDPAYSRLLLDRATRVFAFANRYRGAYSNSLYHAVCPFYCDFNGYQDELL 240
15220676  161 VYKIDKDHSGSEVAGETAAALAAASIVFEKRDPVYSKMLLDRATRVFAFAQKYRGAYSDSLYQAVCPFYCDFNGYEDELL 240
115467438 157 VYKVDPSHPGSDVAAETAAALAAASIVFRDADPDYSNRLLDRAIQVFEFADKYRGPYSSSLHAAVCPCYCDYSGYKDELL 236
224111474 151 VYKIDGSHPGSDVAGETAAALAAASIVFRSRDPAYSRLLLNRAVRVFDFADSHRGAYSSSLHPAVCPFYCDVNGYQDELL 230
224099525 168 AYKIDGSHPGSDVAGETAAALAAASIVFRSRDPAYSRLLLNRAVRVFDFADRHRGAYSGSLRSAVCPFYCDVNGYQDELL 247
242066084 166 VYKVDPSHPGSDVAAETAAALAAGSIVFRDADPAYSKRLLDRAVAVFEFADKYRGPYSSSLHAAVCPCYCDYSGYQDELL 245
255573716 164 VYKIDASHPGSDVAGETAAALAAASIVFRSRDPAYSRLLLDRAVKVFDFADRHRGAYSGSLHSAVCPFYCDVNGYQDELL 243
297845390 161 VYKIDKDHPGSEVAGETAAALAAASIVFEKRDPIYSKMLLDRATRVFAFAQKYRGAYSDSLYQVVCPFYCDFNGYEDELL 240
297841815 161 VYKIDRAHPGSDVAGETAAALAAASIVFRKRDPSYSRLLLDRATRVFAFANRYRGAYSNSLYHAVCPFYCDFNGYQDELL 240
115448507 249 WGAAWLHKASRRREYREYIKKNEVVLGASESINEFGWDNKHAGINVLISKEVLMGKDEYFQSFRVNADNFMCSLLPGISn 328
15223222  241 WGAAWLHKASRKRAYREFIVKNEVILKAGDTINEFGWDNKHAGINVLISKEVLMGKAEYFESFKQNADGFICSILPGIS- 319
15220676  241 WGAAWLHKASKKRVYREFIVKNQVILRAGDTIHEFGWDNKHAGINVLVSKMVLMGKAEYFQSFKQNADEFICSLLPGIS- 319
115467438 237 WGAAWLHKASRRREYRDYIKRNEVVLGASEAINEFGWDNKHAGINVLISKEVLMGKDEYFQSFRVNADNFICTLLPGISn 316
224111474 231 WGAVWLHKASRRRRYREYIVKNEVILHAGDTINEFGWDNKHAGINVLISKEVLMGRAEYFESFKHNADGFICSILPGIS- 309
224099525 248 WGAVWLHKASRRRRYREYVVKNEVILHAGDTINEFGWDNKHAGINVLISKEVLMGRAEYFESFKQNADDFICSILPGIS- 326
242066084 246 WGAAWLHKASRRREYREYIKRNEVVLGASDAINEFGWDNKHAGINVLISKEVLMGKDEYFQSFRVNADNFMCTLLPGISn 325
255573716 244 WGAAWLHKASRRRHYREYIVKNEVVLHAGDTINEFGWDNKHAGINILISKEVLMGKANYFQSFKQNADGFICSILPGIS- 322
297845390 241 WGAAWLHKASKKRVYREFIVKNQVILRAGDTIHEFGWDNKHAGINVLISKMVLMGKADYFQSFKRNADEFICSLLPGIS- 319
297841815 241 WGAAWLHKASRKRAYREFIVKNEVILKAGDTINEFGWDNKHAGINVLISKEVLMGKAEYFESFKQNADGFICSILPGIS- 319
115448507 329 HPQIQYSPGGLLFKVGGSNMQHVTSLSFLLLAYSNYLSHAGARVSCGAgGSASPTQLRRVAKRQVDYILGDNPLRMSYMV 408
15223222  320 HPQVQYSRGGLLVKTGGSNMQHVTSLSFLLLAYSNYLSHAKKVVPCGE-LTASPSLLRQIAKRQVDYILGDNPMGLSYMV 398
15220676  320 HPQVQYSQGGLLVKSGGSNMQHVTSLSFLLLTYSNYLSHANKVVPCGE-FTASPALLRQVAKRQVDYILGDNPMKMSYMV 398
115467438 317 HPQIQYSPGGLLFKVGNSNMQHVTSLSFLLLAYSNYLSHANVRVPCGT-SSASPVQLRRVAKRQVDYILGDNPLRMSYMV 395
224111474 310 HSQVQYSPGGLIFKAGGSNMQHVTSLSFLFLAYSNYLSHANKAVPCGE-KTASPALLKQLAKRQVDYILGDNPLRMSYMV 388
224099525 327 HPQVQYSPGGLIFKAGGSNMQHVTSLSFLLLAYSSYLSHANKVVPCGE-TTASPALLKQLAKRQVDYILGDNPLGMSYMV 405
242066084 326 HPQIQYSPGGLLFKVGSSNMQHVTQLSFLLLAYSNYLSHAGGRVSCGS-SSASPVQLRRVAKRQVDYILGDNPLRMSYMV 404
255573716 323 HPQVQYSPGGLIFKAGGSNMQHVTSLSFLLLAYSNYLSHAKKVVPCGQ-ITASPALLKQLAKHQVDYILGDNPLRMSYMV 401
297845390 320 HPQVQYSQGGLLVKSGGSNMQHVTSLSFLLLTYSNYLSHANKVVPCGE-FIASPTLLRQVAKRQVDYLLGDNPMKMSYMV 398
297841815 320 HPQVQYSRGGLLVKTGGSNMQHVTSLSFLLLAYSNYLSHAKKVVPCGE-LTASPSLLRQIAKRQVDYILGDNPMGLSYMV 398
115448507 409 GYGARFPRRIHHRGSSLPSVAAHPARIGCKGGAAYYASAAPNPNLLVGAVVGGPsDATDAFPDARAVFQQSEPTTYINAP 488
15223222  399 GYGQKFPRRIHHRGSSVPSVSAHPSHIGCKEGSRYFLSPNPNPNLLVGAVVGGP-NVTDAFPDSRPYFQQSEPTTYINAP 477
15220676  399 GYGSRFPQKIHHRGSSVPSVVDHPDRIGCKDGSRYFFSNNPNPNLLIGAVVGGP-NITDDFPDSRPYFQLTEPTTYINAP 477
115467438 396 GYGSRYPLRIHHRGSSLPSVAAHPAQIGCKAGATYYASAAPNPNLLVGAVVGGPsNTSDAFPDARAVFQQSEPTTYINAP 475
224111474 389 GYGPRYPQRIHHRGSSLPSVRAHPARIRCKEGSRYFLSPNANPNVHVGAVVGGP-NVTDAFPDSRPFFQESEPTTYINAP 467
224099525 406 GYGPRYPLRIHHRGSSLPSVQAHPARIRCKEGSRYFLSPNPNPNVHVGAVVGGP-NITDAFPDSRPFFQESEPTTYINAP 484
242066084 405 GYGARFPRRIHHRASSLPSVAAHPARIGCKAGAAYYASPAPNPNLLVGAVVGGPsDASDAFPDARAVFQQSEPTTYINAP 484
255573716 402 GYGERYPQRIHHRASSLPSVQAHPARIGCKAGSKYFLSPNPNPNVLVGAVVGGP-NVSDAFPDSRPFFQESEPTTYINAP 480
297845390 399 GYGSRFPQMIHHRGSSVPSVVDHPGRIGCKDGSRYFLSNNPNPNLLIGAVVGGP-NITDDFPDSRPYFQLTEPTTYINAP 477
297841815 399 GYGQKFPRRIHHRGSSVPSVSVHPSHIGCKEGSRYFLSPNPNPNLLVGAVVGGP-NVTDAFPDSRPYFQQSEPTTYINAP 477
115448507 489 LMGLLAYFSAHPNPA 503
15223222  478 LVGLLGYFSAHSTWR 492
15220676  478 LLGLLGYFSAHY--- 489
115467438 476 LLGLLAYFSAHPNLA 490
224111474 468 LVGLLAFFSTH---- 478
224099525 485 LVGLLAYFSAHP--- 496
242066084 485 LMGLLAYFSAHPNPA 499
255573716 481 LVGLLAYFSAHS--- 492
297845390 478 LLGLLGYFSAHS--- 489
297841815 478 LVGLLGYFSAHSSWR 492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap