Conserved Protein Domain Family
PLN02307

?
PLN02307: PLN02307 
phosphoglucomutase
Statistics
?
PSSM-Id: 177942
View PSSM: PLN02307
Aligned: 38 rows
Threshold Bit Score: 967.969
Threshold Setting Gi: 223999927
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224006313   54 SSSLQMSSSSEVTSVPTTPIEGMKPGTSGLRKKVEVWQGEHYVENFIQSLIDTAVEKNGGkmLDTIVVAGDGRYYNNEAI 133 
159479834   36 SASMAPVAGVTVKPVPTKPYEGQKTGTSGLRKKTKEFMQPNYLANWVQSLFNAL-GDEVN--GKSLGLGGDGRYYGKEAA 112 
159479836    1 ---MAPVAGVTVKPVPTKPYEGQKTGTSGLRKKTKEFMQPNYLANWVQSLFNAL-GDEVN--GKSLGLGGDGRYYGKEAA 74  
145354129    1 --------MVTVREVPTTPIEGQKTGTSGLRKKAAVFSEGNYLANWVQALFGALPRREVE--GSAMVLGGDGRWFNKEAS 70  
219130444  462 LTSNAGLGKLKPTSVSTAPIAGQKPGTSGLRKKVAEFKKENYLNNFVQAAFDAIKASGTDisKGSLVIGGDGRYFNPEAI 541 
223999927    1 -------------------------------------MSKDYLNNFVQSVFDAVIAGGTNvsEGSLMIGGDGRYFNDTAI 43  
255070875    8 RLKTVAAAGIVVTEVPTTPIEGQKTGTSGLRKKAALFSSGNYLANWVQALFCALPSDELK--GSSMVLGGDGRWFNKEAA 85  
302828668   16 TPAMAAVAGLNVKDLPTKPYEGQKTGTSGLRKKTKEFMQENYLANWVQSLFCAL-GDEIK--GQSLGLGGDGRYFGKEAA 92  
302766753    1 ---------IQVKTVPTKPIEGQKTGTSGLRKKVKVFMEQNYLSNWIQSLFNSLSSSDVK--GATLVLGGDGRYFNKPAA 69  
302761732    1 RFSRSSFAVTQVKTVPTKPIEGQKTGTSGLRKKVKVFMEQNYLSNWIQSLFNSLSSSDVK--GATLVLGGDGRYFNKPAA 78  
224006313  134 QTISKLLAANGISNIWIPQHGIMSTPAVSAVIRRRtldgdgedGEGVAQGGIVLTASHNPGGPGEDFGIKYNEGLGQPAG 213 
159479834  113 QIIIKLAAGNGFKKVVVGQDALMATPAASALIRRR-----------HLYGGLIMSASHNPGGPENDFGIKFNYNSGEPAP 181 
159479836   75 QIIIKLAAGNGFKKVVVGQDALMATPAASALIRRR-----------HLYGGLIMSASHNPGGPENDFGIKFNYNSGEPAP 143 
145354129   71 QIILKLAAGNGVKKMYVGRDGYLCTPAASAVIRER-----------GAYGGFIMSASHNPGGPKEDWGIKFNYSSGEPAP 139 
219130444  542 QILIQMGVANGVRRFWIGQDGLLSTPAVSAIIREGg------pRWQKAFGAFILTASHNPGGPTEDFGIKYNCEHGEPAP 615 
223999927   44 QTIIKMGVANGVKRFWIGENGLFSTPAVSATIRERg------pVWQKSFGAFILTASHNPGGPEEDFGIKYNTQNGGPAP 117 
255070875   86 QIIIKLAAGNGVGKVFVGQNGYLATPAASAVIRAR-----------KAYGGFIMSASHNPGGPDEDWGIKFNYSSGEPAP 154 
302828668   93 QIIIKLAAGNGFKKVVVGQNALMATPAASALIRRR-----------KLYGGLIMSASHNPGGPDNDFGIKFNYTGGEPAP 161 
302766753   70 QIIMKIAAGNGVKKVFVARDGIMSTPAVSAVIRKR-----------KANGGFIMSASHNPGGPKNDWGIKFNYSSGQPAP 138 
302761732   79 QIIMKIAAGNGVKKVFVARDGIMSTPAVSAVIRKR-----------KANGGFIMSASHNPGGPKNDWGIKFNYSSGQPAP 147 
224006313  214 EDFTDALYDKTLEISSYKTISNSPSIDLSAPIGTQYKLTP---TSTVTIIDPYRNYLDA-LKSCFDFDSLKEFGKREGFS 289 
159479834  182 ERITDKIFGETSKVATLNMA-DIPDVDLSKVGVTKFg------EFEVEVVDPVADYLAQ-LKEVFDFALLKKFLSRKDFT 253 
159479836  144 ERITDKIFGETSKVATLNMA-DIPDVDLSKVGVTKFg------EFEVEVVDPVADYLAQ-LKEVFDFALLKKFLSRKDFT 215 
145354129  140 EKITDAIYGFTQTVDTLKMA-DIPDVDLSVCGVTKFg------DFEVEVIDPVADYLKL-LKRVFDFDLIKSLLTRPDFK 211 
219130444  616 ERMTDEIYANTTTIKSYKICKEFPNIDIGAAGHSKIMSDDgsaEVNIEVIDSTEAHVKL-LKSIFDFSAIRGLLDRPDFS 694 
223999927  118 EYLMEATYTNTTTIKSYKICEDFPTIDINKVGSTTVTAEDgstSVVVEVIPSTESHVAL-LKTIFDFDAIKALLDRPDFS 196 
255070875  155 EKITDKIYGYTQTVELLKMA-DMPDVDLTTCGAHKFg------DFEVEVIDPVSDYLNL-AEKVFDFDLIKSLLRRSDFK 226 
302828668  162 ERITDKIYGETTKVSVLHMA-DIPDVDLSKVGVTKFg------DFEVEVVDPVEDYLAT-LQSVFDFPLLKSFLARRDFS 233 
302766753  139 EVITDKIYGNTQSIKEIKMA-DIPDVNLSKLGTYKFg------SFTVEVIDP----------SVFDFPLLKSLLSRSDFS 201 
302761732  148 EVITDKIYGNTQSIKEIKMA-DIPDVNLSKLGTHKFg------SFTVEVIDPIGNFSLLsVQSVFDFPLLKSLLSRSDFS 220 
224006313  290 MLFDGMHGAGGQFAQRVLVEELGLPESSLMRCNPLSDFGKCHPDPNLTYASELVKKMGLLADgSAdlsldATTLPALGAA 369 
159479834  254 MVFDAMHAVTGPYAKRILVEELGAPASAVLNGVPSPDFNGGHPDPNLTYAEELVKIM-------W-----ADEAPAFGAA 321 
159479836  216 MVFDAMHAVTGPYAKRILVEELGAPASAVLNGVPSPDFNGGHPDPNLTYAEELVKIM-------W-----ADEAPAFGAA 283 
145354129  212 MQFDAMHAITGAYAKPIFVDELGASPDSCVNAVPKEDFAGGHPDPNLTYAEELVKVM-------F-----SADAPDFGAA 279 
219130444  695 MVYDAMHGVNGPYVKKVFCDILGQDLSVTLNCVPKDDFNGGHADPNLTYAKELVAVMGLNRKgEKid-mgGRPIPSFGAA 773 
223999927  197 MVYDSMHGVNGPFSKAVFVDELDQPESVLRNHIPKDDFNGGHADPNLTYAKELVKTMGLDRTgNKie--tDGPIPSFGAA 274 
255070875  227 MKFDAMHAITGAYAKPILVDALGADPSCCVNDVPKEDFAGGHPDPNLTYAEELVKTM-------F-----SEEAPDFGAA 294 
302828668  234 LVFDAMHAVTGPYAKRILVEELGAPASCVKDGVPSPDFNGGHPDPNLTYAEELVKIM-------W-----ADESPAFGAA 301 
302766753  202 FKFDAMHAVTGAYAEPIFVDVLGAKKGSVNNGVPKEDFGGGHPDPNLTYAEELVELM-------F-----SPDAPDFGAA 269 
302761732  221 FKFDAMHAVTGAYAEPIFVDVLGAKKGSVNNGVPKEDFGGGHPDPNLTYAEELVELM-------F-----SPDAPDFGAA 288 
224006313  370 NDGDGDRNLIAGAGFFVTPSDSMALICDNW-ESIPQFAsrGGLKGVARSMPSSAALDVVAEARGIPCFVTPTGWKFFGNL 448 
159479834  322 SDGDGDRNMVLGHKFFVNPSDSVALIAANAqACIPYFK--GGLKGVARSMPTSGALDRVAAALNVPFFETPTGWKFFGNL 399 
159479836  284 SDGDGDRNMVLGHKFFVNPSDSVALIAANAqACIPYFK--GGLKGVARSMPTSGALDRVAAALNVPFFETPTGWKFFGNL 361 
145354129  280 SDGDGDRNMILGNNFFVTPSDSVAIIAANAvECIPYFK--SGLKGLARSMPTAAALDRVAAGLGVECFETPTGWKFFGNL 357 
219130444  774 ADGDGDRNMILGTQFFVSPSDSLAVIVANA-DTIPFFRtqGGLKGVARSMPTSGAVDLVAKDLNYSLFETPTGWKYFGNL 852 
223999927  275 ADGDGDRNMILGSQFFVTPSDSLAIIVANA-NCIPFFStqGGLKAVARSMPTSGAVDLVAKDLNLDFFETPTGWKFFGNL 353 
255070875  295 SDGDGDRNMILGSNFFVTPSDSVAIIAANAqSCIPYFSgaGGLKGLARSMPTAAALDRVATSLGVECFETPTGWKFFGNL 374 
302828668  302 SDGDGDRNMILGHKFFVNPSDSVAIIAANAqSCIPYFK--GGLKGVARSMPTSGALDRVAADLGVPFFETPTGWKFFGNL 379 
302766753  270 SDGDGDRNMILGNNFFVTPSDSVAMIAANAqPCIPYFK--KGIKGLARSMPTSAALDRVAQKLKVPFFEVPTGWKFFGNL 347 
302761732  289 SDGDGDRNMILGNNFFVTPSDSVAMIAANAqPCIPYFK--KGIKGLARSMPTSAALDRVAQKLKVPFFEVPTGWKFFGNL 366 
224006313  449 MSSKEMfdgkdytpFLCGEESFGTGSDHVREKDGLWAVLAWMSILSnANEDAASDAPLVGVKDIVEKHWAKYGRHFYCRY 528 
159479834  400 MDAGKC--------SVCGEESFGTGGDHIREKDGLFAVLAWLSILAyRNKDVPEGGKLVTVADVCTEHWKQYGRNFFSRY 471 
159479836  362 MDAGKC--------SVCGEESFGTGGDHIREKDGLFAVLAWLSILAyRNKDVPEGGKLVTVADVCTEHWKQYGRNFFSRY 433 
145354129  358 MDAGRL--------SVCGEESFGTGADHVREKDGPWAVLAWLSILAyRNKDVPVGGKKVSVEQITKEHWAKYGRNFFSRY 429 
219130444  853 MDSKELfdgaeytpFICGEESFGTGSDHIREKDGLWAVLAWLSILAhANTNSLS-DTLVTVEDIVKAHWAKYGRNYYSRW 931 
223999927  354 MDSKAVfkgkdytpFICGEESFGTGSDHVREKDGIWAVLAWLNILAaQNNDAS--KPLVTVEDIVRKHWATYGRNYYCRW 431 
255070875  375 MDAGRL--------SICGEESFGTGSDHIREKDGPWAVLAWLSILAhRNKDVPVGGKKVTVEQITREHWAKYGRNFFSRY 446 
302828668  380 MDAGKC--------SVCGEESFGTGGDHIREKDGIFAVLSWLSIVAaKNKDVPEGGQLVTVQDVAVAHWKKYGRNFFSRY 451 
302766753  348 MDAGKL--------SICGEESFGTGSDHIREKDGIWAILAWLSILAhRNKGKKVGDKLVTVEDVAREYWANYGRNFFSRY 419 
302761732  367 MDAGKL--------SICGEESFGTGSDHIREKDGIWAILAWLSILAhRNKGKKVGDKLVTVEDVAREYWANYGRNFFSRY 438 
224006313  529 DYEGVDSNDANNVMDLIRDNfVNSDASSVEAGESGIKLMDavEFSYTDPVDGSQTSKQGLILNFQlpsgDPARVVFRLSG 608 
159479834  472 DYEECASADADKMVAHLRDV-IAKSKAGDKIGEFTLATAD--DFEYTDPIDGSKASKQGLRFVFT----DGSRIIFRLSG 544 
159479836  434 DYEECASADADKMVAHLRDV-IAKSKAGDKIGEFTLATAD--DFEYTDPIDGSKASKQGLRFVFT----DGSRIIFRLSG 506 
145354129  430 DYEGCESDPCNAMVESLRAK-AAASKKGDKYGDYELDYAD--DFEYTDPIDGSVSKNQGVRFVFT----DGSRFIFRLSG 502 
219130444  932 DFENMNATKANAMMDKMRAE--TDANTGKTVGKYSIEKSD--DFVYVDPVDGSVAKKQGMRFLMT----DGSRIIFRLSG 1003
223999927  432 DFEGMDGPGANAMMDKMRAD--TAANTGRVVGSYTIATAD--DFRYVDPVDGSVAEKQGIRFLMS----DGSRVIFRLSG 503 
255070875  447 DYEGCESQPCNEMMQHLRAI-ADSSKKGDKYGPYELDFAD--DFEYTDPIDGSVARNQGLRFVFT----DGSRFIFRLSG 519 
302828668  452 DYEECASADANKMVDHLRSV-IAAAKPGDKFGDFTLATAD--DFEYTDPIDGSKASKQGLRFIFT----DGSRIIFRLSG 524 
302766753  420 DYEECDAASANKMIDHLRSL-IAKSKKGDKYGKYSLALAD--DFKYVDPIDGSVSSKQGIRFIFS----DGSRFIFRLSG 492 
302761732  439 DYEECDAASANKMIDHLRSL-IAKSKKGDKYGKYSLALAD--DFKYVDPIDGSVSSKQGIRFIFS----DGSRFIFRLSG 511 
224006313  609 TGSAGATIRMYLEQYEKDTSKHGMSAPVALKDLAEKALSLVQMEKLTGRDTPTVIT 664 
159479834  545 TGSSGATIRMYIEQYTADPAKLMLDAQVALGPIIQVALELSQLQKFTGRERPTVIT 600 
159479836  507 TGSSGATIRMYIEQYTADPAKLMLDAQVALGPIIQVALELSQLQKFTGRERPTVIT 562 
145354129  503 TGSSGATVRMYIEQYEADPAKQGADAQVALAPLIKIALETSELAKFTGRESPTVIT 558 
219130444 1004 TAGSGATVRMYIEQYE--PTKIDMVASEALADLIRVALDLSDLKGFLGTEEPTVIT 1057
223999927  504 TAGSGATVRMYIEQYETE--KLDQPVASALEELTKIALELCDIKTFCGTETPTVIT 557 
255070875  520 TGSSGATVRMYIEQYESDASKQNIDAQEALGPLIQVALETSKLKEFTGRDSPTVIT 575 
302828668  525 TGSSGATIRLYIEQYTSDPAKLMLDAQEALGPIIKVALEVSKLQEFTGRSSPTVIT 580 
302766753  493 TGSAGATIRLYVEQYETDKSKHDLDAQEALRPLIEIALKVSKLKDFTGRDKPTVIT 548 
302761732  512 TGSAGATIRLYVEQYETDKSKHDLDAQEALKPLIEIALKVSKLKDFTGRDKPTVIT 567 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap