Conserved Protein Domain Family
PLN02306

?
PLN02306: PLN02306 
hydroxypyruvate reductase
Statistics
?
PSSM-Id: 177941
View PSSM: PLN02306
Aligned: 9 rows
Threshold Bit Score: 676.576
Threshold Setting Gi: 302835461
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302835461   1 MPRParpekvhysscrkeptqpqseskigfaqrafastatvngIPVEVHNESGSKRVVVTKSLPGDRWLQYLVNADCRVE 80 
15220620    1 MAKP---------------------------------------VSIEVYNPNGKYRVVSTKPMPGTRWINLLVDQGCRVE 41 
115443619   1 MAKP---------------------------------------ISIEVWNPSGKYRVVSTKSMPGTRWIRLLADNDCRLE 41 
167999295   2 AAKQ---------------------------------------LAVQVHNAGGTLRVLSTKPMPGTQWIKTLTSVGCRVE 42 
168065361   1 MARK---------------------------------------LAVQVYNAGGHLRVVSTKPMPGNQWIQALTSVGCRVE 41 
224078341   1 MAKP---------------------------------------ISIEVYNPNGKYRVVSTKSMPGTRWINLLIEQDCRVE 41 
225428049   1 MAKP---------------------------------------VSIEVWNPCGKYRVVSTKPMPGTRWIDLLVQQDCRVE 41 
255581842   1 MAKP---------------------------------------VQIEVWNPNGKYRVVSTKSMPGTRWINLLIEQDCRVE 41 
297841525   1 MAKP---------------------------------------VSIEVYNPNGKYRVVSTKPMPGTRWINLLVDQGCRVE 41 
302835461  81 VCKHTDIILSNATIKQLLGTKCDGVIGQLTEDWGAELFEALRQAGGKAYSNYAVGYNNVKVQEATKRGIPVGNTPGVLTE 160
15220620   42 ICHLKKTILSVEDIIDLIGDKCDGVIGQLTEDWGETLFSALSKAGGKAFSNMAVGYNNVDVEAANKYGIAVGNTPGVLTE 121
115443619  42 ICTETKTILSVDDILALIGDRCDGVIGQLTEEWGEVLFSALKRAGGTAFSNMAVGYNNVDVEAANRNGIAVGNTPGVLTE 121
167999295  43 VCTEPKVILSTDDIVSLIGNKCDGVIGQLTEDWGDTLFGALKKAGGHAYSNMAVGYNNVDVDAATRHGISVGNTPGVLTE 122
168065361  42 VCVENKTILSVDDILSLIGTKCDGVIGQLTEDWGDVLFAALKKAGGHAYSNMAVGYNNVDVEAATRHGIAVGNTPGVLTE 121
224078341  42 ICTQQKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKHGVAVGNTPGVLTE 121
225428049  42 ICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFSALSRAGGRAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTE 121
255581842  42 ICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLTE 121
297841525  42 ICHLKKTILSVEDIIDLIGDKCDGVIGQLTEDWGETLFSALSKAGGKAFSNMAVGYNNVDVEAASKYGIAVGNTPGVLTE 121
302835461 161 TTAELAAALTLAAARRVVEADTFMRGGHYKGWLPSLFVGQLLQNKTVGIIGAGRIGAAYARMMVEGHKMNLVYYDPYPNK 240
15220620  122 TTAELAASLSLAAARRIVEADEFMRGGLYEGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYFDLYQST 201
115443619 122 TTAELAASLSLAAARRIVEADQFMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMIEGFKMNLIYYDLYQST 201
167999295 123 TTAELAAALTLAAARRVVEADDFMRAGKYEGWLPTLFVGNLLKGQTVGIIGAGRIGTAYARMMVEGFKMNVIYYDLYQAT 202
168065361 122 TTAELAAALTLSAARRVVEADDFMRAGKYEGWLPTLFVGNLLKGQTVGIIGAGRIGTAYARMMVEGFKMNVIYYDLYQST 201
224078341 122 TTAELAASLSLAAARRIVEADQFMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQST 201
225428049 122 TTAELAASLSMAAARRIVEADEFMRAGLYDGWLPHLFVGNLLRGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQAT 201
255581842 122 TTAELAASLSLAAARRIVEADEFMRAGLYDGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYFDLYQAT 201
297841525 122 TTAELAASLSLAAARRIVEADKFMRGGLYEGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYFDLYQST 201
302835461 241 QLEEYIRLYGELLRHRGEPPVAARRVETVEEVLQEADVVSLHCNLDDSTRHLINSQRLALMKKDAVLVNAARGPCIDEVA 320
15220620  202 RLEKFVTAYGQFLKANGEQPVTWKRASSMEEVLREADLISLHPVLDKTTYHLVNKERLAMMKKEAILVNCSRGPVIDEAA 281
115443619 202 RLEKFVTAYGQFLKANGEQPVTWKRAATMEDVLREADVISLHPVLDKTTYHLINPERLAIMKKEAVLVNASRGPVIDEVA 281
167999295 203 RLEKFVSAYGQFLESQGETPVHWRRASSPEDVLKEADVVSLHPVLDKTTYHLINKERLALMKKDAVLVNASRGPVVDETA 282
168065361 202 RLEKFVTAYGEFLKTQGEAPVHWRRASSPEDVLREADVISLHPVLDKTTYHLINKDRLALMKKEAVLVNASRGPVIDEVA 281
224078341 202 RLEKFVTAYGEFLKANGEQPVTWKRAASMDEVLREADVISLHPILDKTTYHLINKESLATMKKEAILVNCSRGPVVDEVA 281
225428049 202 RLEKFVTAYGQFLKASGEQPVTWKRAASMDEVLREADLISLHPVLDKTTYHLVNKERLSMMKKEAILINCSRGPVIDEVA 281
255581842 202 RLEKFVTAYGAFLQANGEQPVTWKRASSMDEVLRVADVISLHPVLDKTTYHLINKESLATMKKEAILVNCSRGPVIDEVA 281
297841525 202 RLEKFVTAYGQFLKANGEQPVTWKRASSMEEVLREADLISLHPVLDKTTYHLVNKERLAMMKKEAILVNCSRGPVIDEAA 281
302835461 321 LVAHLKANPDFRCGLDVFEDEPAMKPGLADCPNAVIVPHIASASMWTRSGMATLAAANVAGVLSGFPVWNKIDILPFVEK 400
15220620  282 LVEHLKENPMFRVGLDVFEEEPFMKPGLADTKNAIVVPHIASASKWTREGMATLAALNVLGRVKGYPIWHDPNRVDPFLN 361
115443619 282 LVEHLKANPMFRVGLDVFEDEPYMKPGLADMKNAVVVPHIASASKWTREGMATLAALNVLGKIKGYPVWGNPNLVEPFLK 361
167999295 283 LVEHLKANPMFRVGLDVFEDEPYMKPGLGELSNAVVVPHIASASKWTREGMATLAAQNVAAKLKGWPVWSSPN-VEPFLD 361
168065361 282 LVEHLKANPMFRVGLDVFEDEPYMKPGLGDLPNAVVVPHIASASKWTREGMATLAAQNVAAKLKGYPVWPNSNNIEPFLD 361
224078341 282 LVEHLKQNPMFRVGLDVFEDEPYMKPGLADMKNAVVVPHIASASKWTREGMATLAALNVLGKIKGYPVWGDPNRVAPFLN 361
225428049 282 LVAHLKENPMFRVGLDVFEDEPYMKPGLAEMKNAIVVPHIASASKWTREGMATLAALNVLGKIKGYPIWHDPNKVEPFLN 361
255581842 282 LVEHLKQNPMFRVGLDVFEDEPYMKPGLAEMKNAIVVPHIASASKWTREGMATLAALNVLGKIKGYPVWGNPNQVEPFLN 361
297841525 282 LVEHLKENPMFRVGLDVFEEEPFMKPGLADMKNAIVVPHIASASKWTREGMATLAALNVLGRVKGYPIWHDPNRVDPFLN 361
302835461 401 PMASVPQASPSIVNAKELGLKLVAD 425
15220620  362 ENASPPNASPSIVNSKALGLPVSKL 386
115443619 362 EDATPPAACPSIVNAKQLGLPSSKL 386
167999295 362 EIKPAPKAAPSIINAKALCLSSMP- 385
168065361 362 ESKPAPAAAPSIVNAKALGLPTGDG 386
224078341 362 ENAPPPAASPSIVNAKALGLPVSKL 386
225428049 362 ENSLPPAASPSIVNAKALGLPVSKL 386
255581842 362 ENAPPPAASPSIVNAKALGLPVSKL 386
297841525 362 ENASPPNASPSIVNSKALGLPVSKL 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap