Conserved Protein Domain Family
PLN02298

?
PLN02298: PLN02298 
hydrolase, alpha/beta fold family protein
Statistics
?
PSSM-Id: 165939
View PSSM: PLN02298
Aligned: 8 rows
Threshold Bit Score: 619.1
Threshold Setting Gi: 168015000
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242050580   2 QADGDAPAPAPAVHFWGEHPatEAEFYAAHGAEGEPSYFTTPdaGARRLFTRAWRPRAPeRPRALVFMVHGYGNDVSWTF 81 
168015000   5 VGTLSGSATETPPFPWGHTP--EEEYYASKNITHQSEFTKFP--RGVSLFTQSWVPSNR-PPKALILMVHGYGNDSSWVF 79 
115472831   1 MPDGERHEEAPDVNFWGEQPatEAEYYAAHGADGESSYFTPP--GGRRLFTRAWRPRGDgAPRALVFMVHGYGNDISWTF 78 
15220284    1 ---MSDQQLETEINFWGETS--EEDYFNLKGIIGSKSFFTSP--RGLNLFTRSWLPSSSsPPRGLIFMVHGYGNDVSWTF 73 
224113991   1 MEQENLKPRETEVHFWGNTP--EDEYYKQQGIKASRSSYTSP--RGLSLFTRSWLPISTdPVLGVMCMVHGYGNDISWTF 76 
225468602   1 ---MDETDHQNRPYFWGNTP--EEEYYNLQGIKSSKSLFTST--RGLSLFTRSWQPLST-PPRALICMVHGYGNDISWTF 72 
255560780   1 MEEQQNLSTETELHYWGKTP--EEEYYKQQGIRASHSSYTSP--RGLSLFTRRWFPDSSsPPRSILCMVHGYGNDISWTF 76 
297843932   1 ---MSDHQLETEMNFWGETS--EEDYFNLKGIIGSKSFFTSP--RGLNLFTRSWLPSSSsPPRGLIFMVHGYGNDVSWTF 73 
242050580  82 QSTAVFLARSGFACFAADLPGHGRSHGLRAFVPDLDAAVADLLAFFRAVRAREE-HAGLPCFLFGESMGGAICLLIHLrT 160
168015000  80 QNTAILFTEMGYAAFALDLYGHGRSEGLLGYIPGVDNLVEDCAFYFNSVKNRAA-YQNLPRFLYGESLGGALCLLLHF-E 157
115472831  79 QSTAVFLARSGFACFAADLPGHGRSHGLRAFVPDLDSAIADLLAFFRSVRRREE-HAGLPCFLFGESMGGAICLLIHLrT 157
15220284   74 QSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFFNSIKQNPK-FQGLPRFLFGESMGGAICLLIQF-A 151
224113991  77 QSTAIFLAQMGFACFGLDIEGHGKSQGLKGYVPNVDLVVQDCLSFFDSIKNDTQ-FHGLPFFLYGESMGGAICLLIHL-A 154
225468602  73 QATPIFLAQMGFACFALDLQGHGQSEGLKAYVPNVDLVVEDCVSFFNSIKQDVS-FHGLPSILYGESMGGAICLLIHL-S 150
255560780  77 QSTAIFLAQMGFACFGIDIEGHGRSQGLKGYVPNVDLVVQDCLSFFNFVRQEDPiLHGLPSFLYGESMGGAICLLIHL-A 155
297843932  74 QSTPIFLAQMGFACFALDIEGHGRSDGVRAYVPSVDLVVDDIISFFNSIKQNPK-FQGLPRFLFGESMGGAICLLIHF-A 151
242050580 161 RPEEWAGAVLVAPMCRISDRIRPPWPLPEILTFVARFAPTAAIVPTADLIEKSVKVPAKRIVAARNPVRYNGRPRLGTVV 240
168015000 158 NPTGYDGAILMAPMCKISEKMVPPWPVEYALRFIARWAPTLPVVPTTDLVDKSVKDPAKRILAKNNPHRYAGKPRLGTVI 237
115472831 158 PPEEWAGAVLVAPMCKISDRIRPPWPLPQILTFVARFAPTLAIVPTADLIEKSVKVPAKRLIAARNPMRYSGRPRLGTVV 237
15220284  152 DPLGFDGAVLVAPMCKISDKVRPKWPVDQFLIMISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRYNEKPRLGTVM 231
224113991 155 NPKGFDGAVLVAPMCKISDSIKPRWPISDILLLVAKFLPTLAIVPAASILHKSIKVERKVPIAEMNPMRYRGKPRLGTVV 234
225468602 151 NPNSFQGAILVAPMCKISDNVRPRWPIPQILTFLARFFPTLPIVPTPDILDKSVKVPEKKIIAAMNPLRYKGKPRLGTVV 230
255560780 156 NPNGFDGAILVAPMCKIADDMKPRWPIPEVLSFVAKFLPTLAIVPTADVLSKSIKVEKKKKIGQMNPMRYREKPRLGTVM 235
297843932 152 DPVGFDGAVLVAPMCKISDKVRPKWPIDQFLIMISRFLPTWAIVPTEDLLEKSIKVEEKKPIAKRNPMRYNEKPRLGTVM 231
242050580 241 ELLRATDELGKRLGEVSIPFLVVHGSADEVTDPEVSRALYAAAASKDKTIKIYDGMLHSLLFGEPDENIERVRGDILAWL 320
168015000 238 ELLRVTASLEEKLKDVSLPFIVLHGNADVVTEPAVSTFLYETAKSEDKTLRIYEGMLHSLIQGEPDENVAIILNDISSWL 317
115472831 238 ELLRATDELGARLGEVTVPFLVVHGSADEVTDPDISRALYDAAASKDKTIKIYDGMMHSMLFGEPDENIERVRADILAWL 317
15220284  232 ELLRVTDYLGKKLKDVSIPFIIVHGSADAVTDPEVSRELYEHAKSKDKTLKIYDGMMHSMLFGEPDDNIEIVRKDIVSWL 311
224113991 235 ELLRVTDYLSQNLRNVTIPFIVLHGSMDVVTDPKVSESLYEEAKSEDKTIKIYDGMVHSLLFGETDENVEIVRQDIISWL 314
225468602 231 ELLRITDYLSQKLGEVKLPFIVLHGSADAVTDPDVSRALYEEAKSEDKTIKIYYGMMHSLLFGETDENVDIVRREILSWL 310
255560780 236 ELLRVTEYLSKRICDVSIPFIVLHGRADVVTDPNVSKALYEEAKSEDKTIKIYDGMMHSLLFGETDENIETVRRDILSWL 315
297843932 232 ELLRVTDYLGNKLKDVSIPFIVVHGSADAVTDPDVSRELYEHAKSKDKTLKIYEGMMHSMLFGEPDDNIEIVRKDIVSWL 311
242050580 321 NERCTPPATPWHRDIP 336
168015000 318 DERVQCKSPPEEDSAS 333
115472831 318 NERCTPREEGSFLTIQ 333
15220284  312 NDRCGGDKTKTQV--- 324
224113991 315 NDRCKQNYQ------- 323
225468602 311 KASAAAAAATSKNFGG 326
255560780 316 NERCKGTY-------- 323
297843932 312 NDRCGGGDKTKT---- 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap