Conserved Protein Domain Family
PLN02297

?
PLN02297: PLN02297 
ribose-phosphate pyrophosphokinase
Statistics
?
PSSM-Id: 177934
View PSSM: PLN02297
Aligned: 29 rows
Threshold Bit Score: 471.096
Threshold Setting Gi: 219111447
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297843888  85 TMAAAASESGPK-----SSKRVCLFHSDETRDLAERIVA----KSDCIELRSIN--WKKFDDGFPNLFIQNAQGIRGQHV 153
159472701  69 TTNIEATQIPAA-----LRKDCVLFYTPDTEELAQKVAQq---AGGAITLGRIK--WKKFADGFPDLFVENATSIRNRHV 138
145354645   1 -----------------------------MEPLARKVAEe---SDHMVELGQID--WRTFPDGFPDLFINDAYDVRDRHV 46 
145354332   1 ----------------------MLFYCTEMEQMAREIAA----IDGNIELGEIQ--WRTFADGFPNIFVNDAEQLHGRHV 52 
145354263   1 -------------------MPLMLFYCTEMEQMAREIAA----IDGNIELGEIQ--WRTFADGFPNIFVNDAEQLHGRHV 55 
255089228  27 STAALPRLQRLDk----GNKYPVLFYAPEMEALAQQIAGed-vCGSSVELGSID--WRTFPDGFPNLFVNDAYGVRDRHV 99 
255075735   1 -MDEAKRTRRDSfgpwgDPSIKYLYYCPQMKELAHSIAA----QPTKLTIRPMEvsWAKFPDGFPNLFVEGAEEIRGKHV 75 
302801522   1 -------------mvwpNRKEVKLFYCSEYEDLARRIAA----ETDSIELKSIR--WNTFEDGFPNLFVPNAHGIRGQHV 61 
302847297  69 STNIETAHIPVG-----LRKDCVLFYTPDTEELAQKVAIq---AGGAITLGRIK--WKKFADGFPDLFVENATSIRNRHV 138
303287957   1 -----------------------------MKALAEKIVEedieGGTAVELGSID--WRTFPDGFPNLFVNDAHGVRDRHV 49 
297843888 154 AFLASFSSPAVIFEQLSVIYALPKLFVSSFTLVLPFFPTGTSERMEDEGDVATAFTLARILSNIPTSRGGPTSLVTFDIH 233
159472701 139 AFLASFTNPTVIFEQISVIYALPRLFVSSFTLVLPFFPTGTMERVETEGDIATANTLARLLSNVPPSRGGPTSLVIFDIH 218
145354645  47 AFLGSFHTPEVIFEQLSIIYSLPKMFVASFTLVLPFFPTGTAERVVREGEVATAVTLARILSNIPPSRGGPTSTIIFDIH 126
145354332  53 AFLASFHNASVIFQQLSVIYSLPKMFVASFRLILPFFPTGTFERVDKEGEIPTAVTMARMLSSIPHSRGGPTDMIVFDIH 132
145354263  56 AFLASFHNASVIFQQLSVIYSLPKMFVASFRLILPFFPTGTFERVDKEGEIPTAVTMARMLSSIPHSRGGPTDMIVFDIH 135
255089228 100 AFLASFHSPEVIFEQLSVIYSLPKMFVASFTLILPFFPTGTSERVEREGEIATAVTLARILSNIPPSRGGPCSTLIFDIH 179
255075735  76 AFLASFNNPDTIFEQISVIYSLPKMFIASFTLILPFFPTGTAERVEREGEVPTAVTLARMLSNIPMSRGGPTSTIIFDIH 155
302801522  62 AFLASFSSPAVIFEQLSVIYALPRMFIASFTVVVPFFPTGTSERMEDEGDIATAFTLARILSNIPISRGGPTSLVIFDIH 141
302847297 139 AFLASFTNPTVIFEQISVIYALPRLFVSSFTLVLPFFPTGTMERVETEGDIATANTLARLLSNVPPSRGGPTSLVIFDIH 218
303287957  50 AFLASFHSPEVIFEQISVIYSLPKMFVASFTLILPFFPTGTSERVEREGEIATAVTLARILSKIPLSRGGPCSTLIFDIH 129
297843888 234 ALQERFYFGDTILPCFESGIPLLKSRLQSLPDSDNiqfilvtvrhllqISIAFPDDGAWKRFHKQL--QHYPTIVCNKVR 311
159472701 219 ALQERFYFGDAVLPLFESGVPLLLERLRQLPDRDS-------------ITIAYPDEGAWKRFHYQFksEGYPEVICTKVR 285
145354645 127 ALQERFYFGDSILPCFESGIPLLLDRLNELEDSNN-------------VVIAYPDEGAYKRFNSFFaaAGYECIVCTKVR 193
145354332 133 ALQERFYFGDSVTPLFASGIPLLLERLASLEDAAD-------------VVIAYPDEGACKRFHNFF--AKYDEVVCTKVR 197
145354263 136 ALQERFYFGDSVTPLFASGIPLLLERLASLEDAAD-------------VVIAYPDEGACKRFHNFF--AKYDEVVCTKVR 200
255089228 180 ALQERFYFGDNILPCFESGIPLLLNRLTQCEDADN-------------IVIAYPDEGAWKRFHGFF--KGMEEVVCTKVR 244
255075735 156 ALQERFYFGDNITPCFETGIPLLLEEIAALPDKSD-------------VVIAYPDEGAMKRFHTFF--EAFDEVVCTKVR 220
302801522 142 ALQERFYFGDSVLPCFESGIPLLKHRLHQLPDSTN-------------VTIAFPDEGAWKRFNKQF--EHFPTIICTKVR 206
302847297 219 ALQERFYFGDAVLPLFESGVPLLLERLRQLPDKDL-------------ITIAYPDEGAWKRFHYQFksEGYPEVICTKVR 285
303287957 130 ALQERFYFGDNILPYFESGIPLLLNRIAELDDADN-------------IVIAYPDEGARKRFGVFF--KSYEEVVCTKVR 194
297843888 312 MGDKRIVRIKEGDAEGRHVVIVDDLVQSGGTLIECQvlysdstlksKVLAAHGAAKISAYVTHGIFPKSSWKRFKLDTKg 391
159472701 286 DGSKRIVRLKEGEPKDRHVVIVDDLVQSGGTLIECH----------ALLASLGAKHVSAFVTHGVFPNMSWVKFRADLGn 355
145354645 194 EGTKRIVKLKEGEPIGRHVVIVDDLVQSGSTLIECQ----------KLLHRLGAAKVSAYATHGVFPNASWKRFTSTG-- 261
145354332 198 EGDKRIVTIKEGKPTGKHIVIVDDLVQSGGTLIECA----------KVLRREGASAVSAYVTHGVFPNESWRRFT----- 262
145354263 201 EGDKRIVTIKEGKPTGKHIVIVDDLVQSGGTLIECA----------KVLRREGASAVSAYVTHGVFPNESWRRFT----- 265
255089228 245 QGDKRLVKLKEGEPAGRHVIIVDDLVQSGGTLIECQ----------KLLSRLGAVKVSAYVTHGVFPGNSWKKFCAG--- 311
255075735 221 QGDKRLVTLKEGEPAGKHVVIVDDLVQSGGTLIECG----------KVLKARGAKALSAFCTHGVFPNDKHERF------ 284
302801522 207 DGNKRIVRLKEGEAAGRHVVIVDDLVRSGGTLKECQ----------KVLQANGATKVSAYATHGVFPQQTWERFLHAAG- 275
302847297 286 DGSKRIVRLKEGEPKDRHVVIVDDLVQSGGTLIECH----------ALLASLGAKHVSAFVTHGVFPNMSWVKFRADLGg 355
303287957 195 DGEKRLVKLKEGEPAGRHVIIVDDLVQSGGTLIECQ----------KLLSRLGAMKVSAYVTHGVFPNASWKRFTASSG- 263
297843888 392 yyhhytnglnqskqscpflcdilkilvfycfrdagDPAEGLSYFWITDSCGMTVKEVMNKPPFEVLSLAGSIASALQV 469
159472701 356 -----------------------------------GAQDGFRYFWLSDSCPQTVRDVRSKAPFEVLSLAGPIAAALQI 398
145354645 262 -----------------------------------AGGQGFSNFWITDSCPQTVEAVRDAEPFEVLSLARAIADALEV 304
145354332 263 -----------------------------------DPSAGFANFWITDSCPQTVSACSGVAPFVVLKLAGSVAHALNI 305
145354263 266 -----------------------------------DPSAGFANFWITDSCPQTVSACSGVAPFVVLKLAGSVAHALNI 308
255089228 312 -----------------------------------GGGQGFYKFFLTDSCPGTAEAVRGTEPFEILSLARPIAEALHV 354
255075735 285 -----------------------------------TESDMFDNFWITDSCPQTVSRVRGRAPFKVLSLAGRIARALEI 327
302801522 276 -----------------------------------ESEKEFSHFWITDSCPETVKEVIGKPPFEVLTLAGSIAAALHI 318
302847297 356 -----------------------------------GAQEGFRYFWLSDSCPQTVRDVRNKAPFEVLSLAGPIAAALQI 398
303287957 264 -----------------------------------AGGQGFYKFWLTDSCPGTAENVSGVAPFEILSLARPIAEALQV 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap