Conserved Protein Domain Family
PLN02294

?
PLN02294: PLN02294 
cytochrome c oxidase subunit Vb
Statistics
?
PSSM-Id: 177931
View PSSM: PLN02294
Aligned: 10 rows
Threshold Bit Score: 269.425
Threshold Setting Gi: 224058705
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297830146   1 MWRRIVSSQLKTLAADv--VVAASPRRSLAATVRPvgFYLAANRSAISASSFVIPRHFSSESvETPA---KKKVEDVMPI 75 
145332591   1 MWRRIVSSQLKTLAAD---VVAASPRRSIAATTRPvgFYLAANRSAISASSFVIPRRFSSDS-ETPA---TKKVEDVMPI 73 
15232644    1 MWRRIVSSQLKTLAAD---VVAASPRRSIAATTRPvgFYLAANRSAISASSFVIPRRFSSDSvETPA---TKKVEDVMPI 74 
15220092    1 MWRRIVSSHLKSISAVg-sCAAPSCRHAVVESTH---LSLSTRASSIPAYSSIFSRLIGSAAaDTAV---KKRVEDVMPI 73 
255553065   1 MWRRSLSSHLKTLAAS-------SSSRTTSAAASRfaSPKHRSFLSPSPSASIFQRYFTAEAaDGAV---KRRVEDAMPI 70 
225442833   1 MWRGRLSAQLQTLARS---RSAANLTRLVTGDINR--SFISPSPAPFRRTASLFSRQFSAESaDNAVskeKKRVEDVMPI 75 
224058705   1 MWRRLASSHLRTLVTS---TSTTSARSTQS-------LLLNRSIINPSPSTSLFNRYFSADSvDGAV---KKRVEDVMPI 67 
224073766   1 MWRRLASSHLKTLATA---SASASVRSTQF-------LLLNR-----SPSASVFNRYLSAASvDGAV---KKRVEDVMPI 62 
297853038   1 MWRRIVSSNLKSLATAsdfAVASSSRRFVVS--KPvgLHLSTNRSTISASSSLLSRHFSSESaGTSV---KKNVEDVMPI 75 
297839915   1 MWRRIVSSHLKSISAGw-sCAAPSCRHAVVETTH---LSLSTRASSIPAYSSVFSRQIGSTAaDTAV---KRRVEDVMPI 73 
297830146  76 ATGHEKEELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFE 155
145332591  74 ATGHEKEELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFE 153
15232644   75 ATGHEKEELEAELEGRRLDDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFE 154
15220092   74 ATGHEKEELQAELEGRKLDDIDFPEGPFGTKEAPAVVKSYYDMRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFK 153
255553065  71 ATGHEREELEAELQGRDILEINHPVGPFGTKEAPAVVKSYYDKRLVGCPGGEGEDEHDVIWFWLKKGKPHECPVCTQYFV 150
225442833  76 ATGHEREELEAALDGRDILDADHPVGPFGTKEAPAVVQSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSHECPVCSQYFT 155
224058705  68 ATGHEREELEAELEGKKLLDIDYPDGPFGTKEKPAVIKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCTQNFV 147
224073766  63 ATGHEREELEAELEGKKLLDIDFPEGPFGTKEEPSVIKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKPHECPVCTQHFA 142
297853038  76 ATGHEREELEAELEGRRLLDIDYPEGPFGTKESPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCSQYFE 155
297839915  74 ATGHEKEELEAELEGRKLDDIDFPEGPFGTKEAPAVVKSYYDMRIVGCPGGEGEDEHDVVWFWLEKGKHFECPVCTQYFK 153
297830146 156 LEVVGPGGPPDGHGDEDDEHHH 177
145332591 154 LEVVGPGGPPDGHGDEDDEHHH 175
15232644  155 LEVVGPGGPPDGHGDEDDEHHH 176
15220092  154 LEVVGPGGPPDGHGDD----HH 171
255553065 151 LEVVGPGGPPDGHGDDEEDHH- 171
225442833 156 LEVIGPGGPPP-HWDGDDHHHH 176
224058705 148 LEVVGPGGPPDGHGDDDDHHH- 168
224073766 143 LEVVGPGGPPDGHGDDDDHHH- 163
297853038 156 LEVVGPGGPPDGHGDDEDHHH- 176
297839915 154 LEVVGPGGPPDGHGDD----HH 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap