Conserved Protein Domain Family
PLN02293

?
PLN02293: PLN02293 
adenine phosphoribosyltransferase
Statistics
?
PSSM-Id: 177930
View PSSM: PLN02293
Aligned: 41 rows
Threshold Bit Score: 204.907
Threshold Setting Gi: 219125793
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
303284241  14 GPKHFCLDQADDGVKTIAKSLPWYgPKYSPHDVpSFYDVSGITEDPAVFQLVIDFFVARYRaqgpENGPTHIAGFDARGF 93 
168033874   1 ---MSASKDGDPRIQYISDSIRTI-PDFPHKGI-MFRDVTTLLLDHKAFKDTIDIFVERYR----DQKVDVIVGIEARGF 71 
145352195   6 RENHFCLDQNDAAVRAIAAALPWYgPEYSPHDVpSFYDVSGITENPEVFRAVTELFVARYRaq-gEAGPTHIAGFDARGF 84 
159466772   1 ------MADVEAKKEIIKNAIRGI-PDFPHKGI-LFWDVTTIMLNHQAFQYSIDLFAEQYK----DKKIDVVAGFEARGL 68 
115489354  56 AAAAAGGGGFEARVARIASTIRVI-PDFPKPGI-MFQDITTMLLKPDAFRDTIELFVERYK----DKGITVIAGVEARGF 129
219125793   1 -----------------------L-PYFPFKGIpRFYDIGGFLYEPKVFQKIVDVFVDRYR----EIGVDVIAGLDARGF 52 
242086068  42 RQAVVAMASADARLAGIASSIRVI-PDFPKPGI-MFQDITTLLLDPKAFRDTIDLFVERYK----DQGITVVAGVEARGF 115
255086765  10 GAQHFCLDQSDDQVKRIAKSLPWYgPKYSPHDVpSFYDVSGITEDPAVFQLVVDFFVERYRsq-gEDGPTHIAGFDARGF 88 
302836155   1 ------MAEDDAKKEIIKNSIRGV-PNFPKPGI-LFWDVTTIMLNPKAFKYTIDLFVERYK----DKQIDVVAGFEARGL 68 
302761704   1 ---MSREDEGDKRVADIDAAIRVV-PDFPKPGI-KFRDVTTLLSNYKAFKDTIDLFVERYS----DKKIDVVAAIEARGF 71 
303284241  94 LFGPPIALALKLPFVMIRKAGKLPGVLVSSgKYVTEYST-DETVMRVGAISSGDRVVLIDDLIATGGTALAGFDLVDQLG 172
168033874  72 IFGPPIALAIGAKFVPMRKPRKLPGPVIRE-EYSLEYGT-DCIEMHVGAIEKNERVVIVDDLIATGGTLGAAIKLLDKVE 149
145352195  85 LFGPPIAMALNVPFVMIRKAGKLPGVLVSSgTYVTEYST-DETVMRLGSVKAGDRVVLIDDLIATGGTALAGFNLVDQLG 163
159466772  69 IFGAPLALALGVAFVPLRKPGKLPGDKISE-EYKTEYST-DKIEMHVGAIQPGQRVVLVDDLIATGGTLAAGINLVKKAG 146
115489354 130 IFGPPIALALGAKFVPLRKPKKLPGEVISE-EYSLEYGT-DKIEMHVGAVEPNGRAVVVDDLIATGGTLSAAVKLIERAG 207
219125793  53 VLGPPIALALNKPFIMMRKKGKMPNSVSSD-DYTTEYGNrQGLTVQKDKIQKNHRVLIIDDLVATGGTLGSAVSLVKMLG 131
242086068 116 IFGPPIALAIGAKFVPLRKPKKLPGEVISE-EYSLEYGT-DKIEMHVGAVQANDRALVVDDLIATGGTLCAAVKLLERVG 193
255086765  89 LFGPPIALALKIPFVMIRKAGKLPGVLVTSgTYVTEYST-DETVMRLGSVRAGDRVVLVDDLIATGGTALAGFDLVDQLG 167
302836155  69 IFGAPLALELGAAFVPLRKPGKLPGEKIFE-EYKTEYST-DKIEMHLGSILPGQRVVLVDDLIATGGTLAAGINLVKKAG 146
302761704  72 IFGAPIALALGAKFVPLRKPGKLPGETISE-AYTLEYGK-DCMEMHVGAVTAGERALVIDDLIATG----------ERAE 139
303284241 173 ASVHEFAAMVSLPFLDGVGKIHayrdgkyvDVPCFTMVDDSSI 215
168033874 150 AEIVECACLVELVDLKGREKLS--------GKPLYILVEYEGE 184
145352195 164 ARVHEFAAMVSLPFLDGVKKIHeyadgkfkDVPCFTMVDDSTI 206
159466772 147 GVVVEAACVIELPFLKGRDKIQ--------GTDLFVLVEKEGL 181
115489354 208 AEVVECACVIELPELKGRDKLG--------NKPVFVLVKAD-- 240
219125793 132 GVVVECACVVEL------------------------------- 143
242086068 194 AKVVECACVIELPELKGRDKLG--------DRPVFVLVEADA- 227
255086765 168 ARVHEFAAMVSLPFLDGVGKIHaykegkykDVPCFTMVDDASI 210
302836155 147 GVVVEAACVIELPFLKGREKIP--------DTPLFVLVEKEGL 181
302761704 140 AEVVECACVIGLVDQKGQEKLG--------GTPLFVLVECEGD 174
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap