Conserved Protein Domain Family
PLN02291

?
PLN02291: PLN02291 
phospho-2-dehydro-3-deoxyheptonate aldolase
Statistics
?
PSSM-Id: 177928
View PSSM: PLN02291
Aligned: 39 rows
Threshold Bit Score: 897.533
Threshold Setting Gi: 303285328
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168025862   1 MRKSSSQASF------WSAKYWSLNSWRN-KVALQQPNYPDLERLAEVEKTLADMPPLVFAGEARSLEEKLADAALGKAF 73 
145348146  33 ARSADVSATG------ANLKEWNPKSWRQ-REALQQPNYENQAELEEALKVIANRPPLVFAGEARDLQEKLANAAAGNAF 105
168014372  55 VESLKANVTKee---lPGTKGWTPTSWRN-KVALQQPNYPDAEKLAEVEKVLRDYPPLVFAGEARSLEERLGEAALGNAF 130
168013136  27 VESDEDIPGV--------AKDWSPGSWRS-KTALQQPSYPDPEKVAEVVKQMEGYPPLVFAGESRSLEERLGEAALGRAF 97 
168007442  55 VDLLKATTTQve--lpGLQKNWSVNSWRN-KVALQQPKYPDAEKFAEVEKVLGDFPPLVFAGEARSLEERLADAALGNAF 131
159478336  34 IAAPEKQSTPas---lNGTSNWQPTSWRS-KPVVQQPEYLDKQEVVKACEEIARMPPLIFAGECRTLQSRLAKASTGDAF 109
219110605  36 EPPASTAATT------GGNTDWSPRSWRE-REVQQGPNYEDEEELEQAIDTIKKFSPLVFAGEVRSLHEQLARACSGQGF 108
168053135  44 LVVVRAVKTGqd--vpGVAKEWSPASWTK-RKALQQPSYPDPQKVAEVVKQMQGYPPLVFAGEARSLEARLGEAALGRAF 120
224014972   1 ----------------MEQSNWTPHSWRDiVAAKQLPVYENQDELNQAIQTLNRVSPLVFAGEVRSLHEQLARVSQGRGF 64 
302829751  31 VSAVASEPRLvvpsslQGGSSWSPNSWRS-KPALQQPEYQDQAEVVKACEEIARMPPLIFAGECRTLQERLAKAATGEAF 109
168025862  74 LLQGGDCAESFKEFNAVNIRDTFRVLLQMGAVLMFGGQMPVVKVGRMAGQFAKPRSEDTEMVNGTELPSYRGDIINADLP 153
145348146 106 VLFGGDCAESFRDFTSDNVRDTYRVLLQMSVVLMYGSGVPVVKLGRMAGQFAKPRSEDLETIDGLSLPSYRGDNINSCEF 185
168014372 131 LLQGGDCAESFKEFNANNIRDTFRVLLQMGAVLMFGGQMPVVKVGRMAGQFAKPRSADTENVNGVELPSYRGDNINADLP 210
168013136  98 LLQGGDCAESFKEFNANNIRDTFRLLLQMSVVLMFGGQLPVVKVGRMAGQFAKPRSADMEDVNGVSLPSYRGDNINGDAP 177
168007442 132 LLQGGDCAESFKEFNANNIRDTFRVLLQMGAVLMFGGQMPVVKVGRMAGQFAKPRSTNTQTVNGVELPIYRGDIINADLP 211
159478336 110 VLFGGDCAEAFSQFSANRIRDLYRLLLQMSIVLAFGGGVPIVKLGRIAGQFAKPRSASTETIGGVTLPAYRGDIINGPEF 189
219110605 109 LLMGGDCAEAFNEFNVDHVRDSFRVLLQMALVLTFGSAMPVIKVGRMAGQFAKPRSEPDEVRDGVALPSYRGDIINREEF 188
168053135 121 LLQGGDCAESFKEFNANNIRDTFRLLLQMSVVLMFGGQVPVVKVGRMAGQFAKPRSSDFEDVNGVSLPSYRGDNINGDAP 200
224014972  65 VLMGGDCAESFEEFHVNHVRDTFRVLLQMALIMTFGGSMPVVKIGRIAGQFAKPRSSPNEVVDGVTLPSYRGDIVNRKEF 144
302829751 110 VLFGGDCAEAFSQFSANRIRDLYRLLLQMSTVLAFGGGVPIVKLGRIAGQFAKPRSAPTETINGVTLPAYRGDIINGPEF 189
168025862 154 TLEARVPDPTLMVRAYDQAAATLNLLRAFATGGFAAMQRVTQWNLDFAANSEQGDKYRELAHRVDEALGFMAACGLTPEH 233
145348146 186 TPEARRPDPSRLVKAYDQSCATLNLLRAFSNGGYAAMTRVSDWNLDFMENTERGSQYEDLAQRVDAAIDFMAACGIDETH 265
168014372 211 TLEARIPDPDRMVRAYSQAAATLNLLRAFATGGFAAMQRVTHWNLDFAADSEQGDWYRELAHRVDEALGFMAACGLTLDH 290
168013136 178 NLEARVPDPERMVRAYSQSASTLNLLRAFATGGYAAMQRIKDWNLDFASHSEQGDRYRELANRVDEALGFMTACGLPLDS 257
168007442 212 TLEARTPDPDRMVRAYSQAAATLNLLRAFATGGFAAMQRVTHWNLDFATNTEQGEQYRELANRVDEALGFMAACGLTLDH 291
159478336 190 TEEARRCDPWRLVRAYNQSAATLNLLRGFSYGGYAGLSRVSQWELEFMKNTPEGHAYMDIAKRVDEAIQFMIACGMDTNM 269
219110605 189 TPEARRHNPNNMVEAYHQSAQTLNILRAFSTGGYADMSRLHAWNLDFVETTDEGSRYRKFATKVDESLRFMKAIGVDTSS 268
168053135 201 DYDARVPDPARMLRAYSQSASTLNLLRAFATGGFAAMQRIKHWNLDFASRSEQGDRYRELANRVDEALGFMTACGLHLDH 280
224014972 145 TPDARRNDPHRMVDAYYQSAQTLNILRAFSTGGYADITRLHAWNLDFVKNTEEGSRYRLLASKVEESLRFMKAIGVDTSR 224
302829751 190 TPEARRCDPWRLVRAYNQSAATLNLLRGFSYGGYAGLSRVSQWNLDFMKNTAEGHAYMDIAKRVDEAIQFMIACGMDTNM 269
168025862 234 PVMTTTEFYTSHECLLLPYEQAFTRIDSTTGQWYDCSAHMLWIGERTRQLDGAHIEFLRGVANPLGVKVSDKMKPEDLVT 313
145348146 266 PSMQETSFFTAHEALHLGYEESLTRLDSTTEEHYGCSAHFLWCGERTRQPEGAHMEYFRGISNPIGIKISDKSDGEGVVS 345
168014372 291 PVMTSTQFWTSHECLLLPYEQALTREDSTSGLWYDCSAHMLWIGERTRQLDGAHIEFLRGVANPLGVKVSDKMKPEDLVT 370
168013136 258 PVMTTTEFWTSHECLLLPYEQAMTRQDSTSGLWYDCSAHFVWMGERTRQLDGAHIEFLRGVANPLGVKVSDKMDPAELVK 337
168007442 292 PVMTSTQFWTSHECLLLPYEQALTREDSTTGLWYDCSAHMLWIGERTRQLDGAHIEFLRGVANPLGVKVSDKMNPEDLVT 371
159478336 270 PFMRETEFYTCHECLLLDYEEALTRLDSTTDKWYGCSAHFLWCGERTRQLDHAHVEFLRGVNNPIGVKVSDKMDPNDIVS 349
219110605 269 PTFTKTEFYTAHECLLLPYEEALTRKDSTTGRYYDCSGHMLWVGERTRQLDGAHLEFVRGIGNPLGVKISDKCTPEELIR 348
168053135 281 PVMTTTEFWTSHECLLLPYEQAMTREDSTSRLWYDCSAHFLWMGERTRQLDGAHIEFLRGVGNPLGVKVSDKMDPGELVK 360
224014972 225 PEFTSVDFYTAHECLLLPYEQALTRQDSITGKWYDCSAHMLWVGERTRNLDGAHLEFTEGICNPLGVKISDNCTPEDLIQ 304
302829751 270 PFMRETEFYTCHECLLLDYEEALTRMDSTTDRWYGCSSHFLWCGERTRQLDHAHVEFMRGVNNPIGVKVSDKMDPNDIVT 349
168025862 314 LCETLNPDNKPGRLTVIVRMGAAKLREKLPALVRAVRQAGCMVTWVSDPMHGNTIKAPgSGTKTRPFDAILEEVKAFFDV 393
145348146 346 LVKKLNPDNVPGRITLISRMGAAKLREHLPRLITAIEDAGLNVLWVTDPMHGNTIKTD-NGFKTRPFEAVRDEIMAFFEV 424
168014372 371 LCNILNPENKPGRLTVIVRMGATKLREKFPALVRAIRQAGCIVTWVIDPMHGNTVKAP-SGLKTRPFDAILDEVKAFFDV 449
168013136 338 LCEILNPRNKPGRLTVIVRMGAEKLRQKLPALVRAVRQAGIIVTWVCDPMHGNTIKAP-SGIKTRPFDSILDEVKAFFDV 416
168007442 372 LCNILNPDNKPGRLTVIVRMGAAKLREKFPALVRAVRQAGCTVTWVSDPMHGNTVKAP-SGLKTRPFDAILDEVRAFFDV 450
159478336 350 LIASVNPSNTPGRLSIIVRMGAKALRAKLPALIEAVQRSGQVVTWVCDPMHGNTETV--SGFKTRRYENIRSEIEAFFDV 427
219110605 349 IIDTMNPQNIPGRLTIVVRMGAEKVRKNLPALIRAVQREGKSVLWISDPVHGNTYKTD-SGIKTRNFDAIRDELRAFFDV 427
168053135 361 LCEILNPQNKPGRLTVIVRMGAEKLRQKLPALIRAVRQAGIIVTWVSDPMHGNTIKAP-SGLKTRPFDAILEEVKAFFDV 439
224014972 305 TIERMNPHNTPGRLSLIVRMGSDKLKQKLPSLIQAVQDSRKEVVWISDPVHGNTRKTA-SGYKTRDFDSIVAELRAFFDV 383
302829751 350 LIAMLNPSNKPGRLSIIVRMGARKLREKMPALIEAVQRSGQVVTWVCDPMHGNTETV--SGYKTRRYENIRSEIEAFFDV 427
168025862 394 HEQEGTHAGGVHLEMTGQDVTECVGGGINLSYEDLSSRYHTHCDPRLNASQALELSFIIAERLRKRRLDGATDSFLHN 471
145348146 425 HEKMGTYPGGVHLEMTGQNVTECTGGIMDVSVSDLEKRYLTHCDPRLNASQAIELAFLMASELNDMRRRRAAQ----- 497
168014372 450 HEQEGTHAGGVHLEMTGQDVTECVGGGNNLTYDDLSSRYHTHCDPRLNASQALELSFIIAERLRRRRLAGSGNTFLQS 527
168013136 417 HEQEGTHAGGVHLEMTGQNVTECVGGGRTVTFEDLSSRYHTHCDPRLNASQSLELAFIIAERLRKRRIAVSDEKDVLS 494
168007442 451 HEQEGTHAGGVHLEMTGQNVTECVGGGKNLTYEDLSSRYHTHCDPRLNASQALELSFIIAERLRRRRLAGGSNTFFQS 528
159478336 428 HEKMGTVPGGVHLEMTGDNVTECIGGGASISEDDLNSRYHTHCDPRLNAEQSLEIAFYVAQRLRQRRENLAAKTA--- 502
219110605 428 HDEMGSHPGGVHLEMTGEDVTECTGGISGVSEDTLNDRYHTFCDPRLNGAQALELAFLIAERMRLRTGLPPIE----- 500
168053135 440 HDQEGTHAGGVHLEMTGQNVTECVGGGRTVTFDDLSSRYHTHCDPRLNASQSLELAFIIAERLRKRRIAPVMDKEILS 517
224014972 384 HDEMGTHPGGLHLEMTGEDVTECTGGVSAVTEDTLKKHYNTACDPRLNGSQALELAFLIAERMTLRSGLPPI------ 455
302829751 428 HEQMGTVPGGVHLEMTGDNVTECIGGGASISEDDLNSRYHTHCDPRLNAEQSLEIAFYVAQRLRQRRENLAAKTPAAA 505
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap