Conserved Protein Domain Family
PLN02284

?
PLN02284: PLN02284 
glutamine synthetase
Statistics
?
PSSM-Id: 177922
View PSSM: PLN02284
Aligned: 42 rows
Threshold Bit Score: 630.956
Threshold Setting Gi: 168014824
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159469552  12 TGAPRQGRRL--------------------------------------------TVRVQAYGMKAEYIWADGNEGkaekg 47 
159469782  17 AGARSSGRTL--------------------------------------------TVRVQAYGMKAEYIWADGNEGkpekg 52 
159483707  12 DEKIGSLLDQsitr------------------------------------hflsTVTDQQGKICAEYVWIGGSMH----- 50 
168014824   1 ----------------------------------------------------------MALAQKAEYIWMDGQEGqkgi- 21 
219123807   1 MKLNIAAIALfaasasafaprfasprshatvlsavleertgqsqldpavieryaALPYPDDTVLAEYVWVDAVG------ 74 
224012585   1 MKLSIALLSMaatatafapslttpsrttslsmvnpleirtgkaqldhsvidrfnALPYPADKVLAEYVWVDAKG------ 74 
297847110   2 TSPLSDLLNL--------------------------------------------DLSD-TKKIIAEYIWIGGSGM----- 31 
302831704  17 NAGVRAGRTL--------------------------------------------TVRVRAYGMKAEYIWADGNEGrpekg 52 
302831978  14 VGIVRNTRTL--------------------------------------------TVRVRAYGMKAEYIWADGNEGrpekg 49 
302849336  12 DEKIGSLLDQsitr------------------------------------hfltNVTDQCGKITAEYVWIGGSMQ----- 50 
159469552  48 mifnEMRSKTKCFEAPlGLDASEYPDWSFDGSSTGQAEGNNSDCILRPVRVVTDPIR----GAPHVLVMCEVFAP----- 118
159469782  53 mifnEMRSKTKCFEAPlGLDASEYPDWSFDGSSTGQAEGNNSDCILRPVRVVTDPIR----GAPHVLVMCEVFAP----- 123
159483707  51 ----DVRSKSRTLSTI-PTKPEDLPHWNYDGSSTGQAPGHDSEVYLIPRSIFKDPFR----GGDNILVMCDCYEPpkvnp 121
168014824  22 -rfnEMRSKTKVIQEPiKAGSLDFPKWSFDGSSTGQAEGRFSDCILNPVFSCLDPIR----GDNHVLVLCEVLNP----- 91 
219123807  75 ----NTRSKTRTLPAKkAASVEALPKWNFDGSSTDQAPGDDSEVILRPCRIFKDPFRprndGLDNVLVMCDCYTP----- 145
224012585  75 ----ECRSKTRTLPVArTTAVDNLPRWNFDGSSTGQAPGDDSEVILRPCRIFKDPFRprndGVDNILVMCDTYTP----- 145
297847110  32 ----DIRSKARTLPGP-VSDPTKLPKWNYDGSSTDQAAGDDSEVILYPQAIFKDPFR----KGNNILVMCDAYTP----- 97 
302831704  53 mifnEMRSKTKVFDEAlPLEAGQYPDWSFDGSSTGQAAGNNSDCILRPVRVIKDPIR----GEPHVLVMCEVFAP----- 123
302831978  50 mifnEMRSKTKVFDEAlPLEAGQYPDWSFDGSSTGQAAGNNSDCILRPVRVIKDPIR----GEPHVLVMCEVFAP----- 120
302849336  51 ----DLRSKSRTLTSV-PTKPEDLPHWNYDGSSTGQAPGHDSEVYLIPRRIFRDPFR----GGDNILVMCDCYEPpkana 121
159469552 119 ----DG-KPHSTNTRAKLREIID-DKVTAEDCWYGFEQEYTMLAKTSGHIYGWPAGGFPA-PQGPFYCGVGAESAFGRPL 191
159469782 124 ----DG-KPHSTNTRAKLREIID-DKVTAEDCWYGFEQEYTMLAKTSGHIYGWPAGGFPA-PQGPFYCGVGAESAFGRPL 196
159483707 122 dgtlAApKPIPTNTRFACAEVME--KAKKEEPWFGIEQEYTLLNAITKWPLGWPKGGYPA-PQGPYYCSAGAGVAIGRDV 198
168014824  92 ----DS-TPHETNTRRKIEELLT-PDVLAEETLFGFEQEYTMFNKAGK-VYGWPEGGFPH-PQGPFYCGVGLEAVYGRPL 163
219123807 146 ----NG-EAIPTNHRAKAMESFEsRE--DEEIWFGLEQEFTLFNLDKRTPLGWPEGGMPNrPQGPYYCSVGPENNFGRHI 218
224012585 146 ----AG-EALPTNTRAIAAKAFEgKE--DEEIWFGLEQEFTLFNLDQRTPLGWPKGGVPArAQGPYYCSVGPENSFGRAI 218
297847110  98 ----AG-DPIPTNNRNKAVKIFDhPNVKAEEPWFGIEQEYTLLKKDVKWPLGWPLGGFPG-PQGPYYCAVGADKAFGRDI 171
302831704 124 ----DG-TPHPTNTRAKLRDIID-DKVLAEDCWYGLEQEYTMLQKTTGQIYGWPSGGYPA-PQGPFYCGVGAESAFGRPL 196
302831978 121 ----DG-TPHPTNTRAKLRDIID-DKVLAEDCWYGLEQEYTMLQKTTGQIYGWPSGGYPA-PQGPFYCGVGAESAFGRPL 193
302849336 122 dgilQPpKPIPTNTRYACAEAME--KAKDEEPWFGIEQEYTLLNAITKWPLGWPKGGYPA-PQGPYYCSAGAGVAIGRDV 198
159469552 192 AEAHMEACMKAGLVISGINAEVMPGQWEYQIGPVGPLALGDEVMLSRWLLHRLGEDFGIVSTFNPKPVrTGDWNGTGAHT 271
159469782 197 AEAHMEACMKAGLVISGINAEVMPGQWEYQIGPVGPLALGDEVMLSRWLLHRLGEDFGIVSTFNPKPVrTGDWNGTGAHT 276
159483707 199 AEVHYRLCLAAGVNISGVNAEVLPSQWEYQVGPCEGITMGDHMWMSRYIMYRVCEMFNVEVSFDPKPI-PGDWNGSGGHT 277
168014824 164 VEAHMDACIKAGLKISGINAEVMPGQWEFQIGPAGPLEVGDHVMIARWLLHRLGEDFGITCTFEPKPM-EGDWNGAGAHT 242
219123807 219 TESMYRACLYAGINISGTNGEVMPGQQEYQVGPCVGIDAGDQLMMSRYILQRVCEDFQVYCTLHPKPIvDGDWNGAGMHT 298
224012585 219 TDTMYRACLYAGIEISGTNGEVMPGQQEYQVGPCVGIDAGDQLQMSRYILQRVCEEFQVYCTLHPKPIvEGDWNGAGMHT 298
297847110 172 VDAHYKACLYSGLSIGGANGEVMPGQWEFQISPTVGIGAGDQLWVARYILERITEICGVIVSFDPKPI-QGDWNGAAAHT 250
302831704 197 AEAHMEACMKAGLKISGINAEVMPGQWEYQIGPVGPLEMGDEVMLSRWLLHRLGEDFGIVCTFNPKPVrTGDWNGTGAHT 276
302831978 194 AEAHMEACMKAGLKISGINAEVMPGQWEYQIGPVGPLEMGDEVMLSRWLLHRLGEDFGIVCTFNPKPVrTGDWNGTGAHT 273
302849336 199 AEVHYRLCLYAGVNISGVNAEVLPSQWEYQVGPCEGIEMGDHMWMSRYIMYRVCEMFNVEVSFDPKPI-PGDWNGSGGHT 277
159469552 272 NFSTKGMRVP-GGMKVIEEAVEKLSKTHIEHITQYGIGNEARLTGKHETCDINTFKHGVADRGSSIRIPLPVMLKGYGYL 350
159469782 277 NFSTKGMRVP-GGMKVIEEAVEKLSKTHIEHITQYGIGNEARLTGKHETCDINTFKHGVADRGSSIRIPLPVMLKGYGYL 355
159483707 278 NYSTKATRTApDGWKVIQEHCAKLEARHAVHIAAYGEGNERRLTGKHETSSMSDFSWGVANRGCSIRVGRMVPVEKSGYY 357
168014824 243 NYSTKSMRVD-GGIKAIHAAIEKLSKKHVEHISSYGLGNERRLTGKHETANINTFKSGVADRGASIRIPLGVSLDGKGYL 321
219123807 299 NVSTKSMREE-GGLEVIKKAIYKLGAKHLEHIAVYGEGNELRLTGKHETASMDKFCYGVANRGASIRIGRDTEAEGKGYF 377
224012585 299 NVSTKSMREE-GGLEVIKKAIYKLGAKHQEHIAVYGEGNELRLTGKHETASIDQFSFGVANRGASVRIGRDTEAEGKGYF 377
297847110 251 NFSTKSMRKD-GGLDLIKEAIKKLEVKHKQHIAAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKEGKGYF 329
302831704 277 NFSTKSMRQP-GGMKVIEDAVEKLSKTHIEHITQYGLGNEARLTGKHETCDINTFKHGVADRGSSIRIPLPVMLKGYGYL 355
302831978 274 NFSTKSMRQP-GGMKVIEDAVEKLSKTHIEHITQYGLGNEARLTGKHETCDINTFKHGVADRGSSIRIPLPVMLKGYGYL 352
302849336 278 NYSTKATRTApNGWKAIQEHCQKLEARHAVHIAAYGEGNERRLTGKHETSSMNDFSWGVANRGCSIRVGRMVPVEKCGYY 357
159469552 351 EDRRPAANVDPYTVARLLIKTVLKG 375
159469782 356 EDRRPAANVDPYTVARLLIKTVLKG 380
159483707 358 EDRRPASNLDAYVVTRLIVETTILL 382
168014824 322 EDRRPAANVDPYVVARMLIQTTLKN 346
219123807 378 EDRRPSSNADPYIVTGKIMNTIMED 402
224012585 378 EDRRPSSNADPYLVTGKIMATIMED 402
297847110 330 EDRRPSSNMDPYLVTSMIAETTIL- 353
302831704 356 EDRRPAANVDPYTVARLLIKSILKG 380
302831978 353 EDRRPAANVDPYTVARLLIKSILKG 377
302849336 358 EDRRPASNLDPYVVTKLIVETTVLL 382
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap