Conserved Protein Domain Family
PLN02283

?
PLN02283: PLN02283 
alpha-dioxygenase
Statistics
?
PSSM-Id: 177921
View PSSM: PLN02283
Aligned: 14 rows
Threshold Bit Score: 1014.69
Threshold Setting Gi: 302753830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15232116    6 SLISSILLKFIHKDFHEIYARMSLLDRFLLLIVHGVDKMVPWHKLPVFLGLTYLEVRRHLHQQYNLLNVGQTpTGIRFDP 85 
15219521    1 MGFSPSSSWFLHPQLHHVVSKMSYFDAFLFYIVHLVDKLGLWHRFPVLLGVAYLGLRRHLHQRYNLVHVGPI-NGQGYDT 79 
115488462   1 -MGSGLFKPRVHPDLRDVFSKMSFFDKIGFLFIHAFDKRNLWHKVPVPIGLLYLNTRRTLLEKYNLLAVGRSsHGALFDP 79 
225456100   1 MAFSKSSSSFIHPQLLHIVAKMTLFDTFLFYIVHFVDKLGVWHRLPVLLGLAYLGIRRHLHQRYNLLHVGGV-NGGRYDT 79 
225452530  10 SLLTAPLHHFIHEDFHEVVARMTLIDRFLFLIIHSIDKLGIWHRLPVFLGLIYLAIRRHLHEQYNLFNVGSTpRGVRYNP 89 
225452532   6 TLLSAPLLYFIHKDFHGALANMTLIDRFLFLIIHSIDKLGIWYRLPVFLGLVYLLIRRHLHNQYNLFNVGPTpVGVRFNP 85 
224099169  10 KLSSASLRRFIHQDFHEVVDRMTIIDAFLFLIVHSIDKLGIWHRLPVFLGLLYLSVRRHLHQEYSLFNVGRSpTGVRYNP 89 
224121214   1 MAFSLSSSSFIHPQLRHIVYKMNLFDTLLFFVIHFVDKLGLWHRLPVLLGLAYMAIRRHLHQRYNLLHVGGI-NGQKYET 79 
255577350   1 MGFSLLSSPFVHPQLSEIVSKMTLFDTIFFYAIHFVDKMELWHRLPVILGIIYLAIRRHLHQRYNLLNVGGI-NGQKYDT 79 
297842117   1 MGFSPSSSWFLHPQLHHVVSEMSYFDAFIFYIVHLVDKLGLWHRFPVLLGVAYLGLRRHLHQRYNLVHVGPI-NGQGYDN 79 
15232116   86 ANYPYRTADGKFNDPFNEGVGSQNSFFGRNCPPVDQKSKLRRPDPMVVATKLLGRKKFIDTGKQFNMIAASWIQFMIHDW 165
15219521   80 DEFCYRTADGKCNHPSDNTIGSQGSFIGRNMPPSTSQYGILDPHPSVVATKLLARKRFIDNGDQFNVIACSWIQFMIHDW 159
115488462  80 KEFLYRTEDGKYNDPHNAEAGSQNTFFGRNMEPVDQQDELMSPDPFVVATKLLARREYKDTGKQFNILAAAWIQFMVHDW 159
225456100  80 EEFCYRTADGKCNHPIDDQIGSQGTLFGRNMPPSTSSYRLLEPHPTVVATKLLARKKFIDNGKQFNLIACSWVQFMIHDW 159
225452530  90 VDYPYRTADGEYNDPFNEGAGSQGTFFGRNILPVDQKDKLKKPDPMVVATKLLARKDFTDTGKQFNMIAASWIQFMIHDW 169
225452532  86 ADYPYRTADGEYNDPFNDDAGSQGTFFGRNILPVDQKDKLKKPDPTVVATKLMARRNFTDTGKQFNMIAASWIQFMIHDW 165
224099169  90 ADYPYRTADGKYNEPFNEGAGSQGTFFGRNVLPVNQQDKLKKPDPMVVATRLLARKKFIDTGKQFNMIAASWIQFMIHDW 169
224121214  80 EEFSYRTADGKCNHPSDDIIGSQGTFFGRNMLPANSRYGLLDPHPTVVANKLLARNKFIDNGKQFNMIACSWIQFMIHDW 159
255577350  80 NEFSHRTADGKCNHPSDHIIGSQGTFFGRNMPPSSSPYWLLDPHPTVVANKLLARKKFIDNGKQFNMIACSWIQFMIHDW 159
297842117  80 DEFCYRTADGKCNHPSDDSIGSQGSFIGRNMPPSTSQYGILDPHPSVVATKLLARKRFIDNGDQFNVIACSWIQFMIHDW 159
15232116  166 IDHLEDTHQIELVAPKEVASKCPLSSFRFLKTKEVPTGFFEiKTGSQNIRTPWWDSSVIYGSNSKTLDRVRTYKDGKLKI 245
15219521  160 VDHLEDTHQIELEAPEEVASGCPLKSFKFLRTKKVPTDDHH-KSGAVNTRTPWWDGSVIYGNDETGMRRVRVFKDGKLKI 238
115488462 160 MDHMEDTGQIGITAPKEVANECPLKSFKFHPTKELPTNSDGiKIGHYNIRTAWWDGSAVYGNNEERAEKLRTYVDGKLVI 239
225456100 160 IDHMEDTQQIEIKAPSDIASGCPLKSFKFFKSKSIPTGSPHmEDGFLNTRTPWWDGSVIYGNNDDGMRRVRTFKDGKLKI 239
225452530 170 IDHMEDTQQIELTAPREVASQCPLKSFKFYKTKEVATGFYDiKSGSLNIRTPWWDGSAIYGSNEKQLQRVRTFKDGKLKI 249
225452532 166 TDHLEDTQQIELTAPREVASQCPLKSFKFYKTKEVPTGFYDiKTGSLNIRTPWWDGSAIYGNNAKKLQKVRTFKDGKLKI 245
224099169 170 VDHMEETAQIELVAPKEVANQCPLKSFRFYKTKEVPTGFWDiKSGALNIRTPWWDGSAIYGSNEKRLHKVRTFKDGKLKI 249
224121214 160 IDHMEDTQQVELKAPDKIADGCPLKSFKFYKTKKVSTGSPYmKTGSLNTRTPWWDGSVIYGNNEDGMRKVREFKDGRLRI 239
255577350 160 IDHMEDTQQVEIRAPDEIADGCPLKSFKFYKTKKVHTGSPDfRTGCVNTRTPWWDGSVIYGNNEDGMRRVRTFRDGKLKI 239
297842117 160 VDHLEDTHQIELEAPEEVASGCPLKSFKFLRTKKVPTGDHH-KSGAVNTRTPWWDGSVIYGNDEAGMRRVRVFKDGKLKI 238
15232116  246 SEEtGLLLHDEDGLAISGDIRNSWAGVSALQALFIKEHNAVCDALKDEDDDLEDEDLYRYARLVTSAVVAKIHTIDWTVQ 325
15219521  239 SGD-GLLERDERGVPISGDIRNSWSGFSLLQALFVKEHNSVCDMLKERYPDFDDEKLYRTARLVTAAVIAKVHTIDWTIE 317
115488462 240 GDD-GLLLHKENGVALSGDIRNSWAGVSILQALFVKEHNAVCDAIKEEHPNLSDEELYRYAKLVTSAVIAKVHTIDWTVE 318
225456100 240 SND-GLLEHDGKGIPISGDVRNCWAGFSLLQALFVKEHNAVCDMLKVHHPEFDDERLYRHARLVTSAVIAKIHTIDWTVE 318
225452530 250 SED-GLLLHDQDMIPVSGDVRNSWAGVSTLQALFVKEHNAVCDALKKEYRHMNDEELYHRARLVTSAVIAKIHTIDWTVE 328
225452532 246 SED-GFLLHDQDMIPLSGDVRNGWAGLSTLQALFIKEHNAVCDALKKENGHLSDEELYRHARLVTSAVIAKVLTIDWTVE 324
224099169 250 SED-GLLLHDQDGIAVSGDVRNSWAGVSILQALFVKEHNAVCDTLKREYKDLGDEELYRHARLVTSAVIAKVHTIDWTVE 328
224121214 240 AGD-GLLEHDEKGIPISGDVRNCWAGFSLLQALFVKEHNA------ENYPDFDDEKLYRHARLVTSAVLAKIHTIDWTVE 312
255577350 240 AED-GLLEHDEKGIPISGDVRNCWAGFSLLQALFVKEHNAVCDMLREHYPDSDDDKLYQHARLVTSAVIAKIHTIDWTVE 318
297842117 239 SGD-GLLERDERGVPISGDIRNSWSGFSLLQALFVKEHNSICDMLKERYPDFDDEKLYRTARLVTAAVIAKVHTIDWTIE 317
15232116  326 LLKTDTLLAGMRANWYGLLGKKFKDSFGHAGSSILGGVVGMKKPQNHGVPYSLTEDFTSVYRMHSLLPDQLHILDIDD-- 403
15219521  318 LLKTDTLTAGMRINWYGFFGKKVKDMVGARFGPLFSGLVGLKKPNDHGVPYSLTEEFVSVYRMHCLLPETLILRDMNS-- 395
115488462 319 LLKTKTMRAAMRANWYGLLGKKIKDTFGHIGGPILGGLVGLKKPNNHGVPYSLTEEFTSVYRMHSLIPSTLKLRDPTG-- 396
225456100 319 LLKTDTLLAGMRINWYGFMGKKFKDSFGHILGPILSGLVGLKKPRDHGVPYSLTEEFVSVYRMHALLPDELHIRDTNSsn 398
225452530 329 LLKTDTLLAGMRANWYGLLGKKFKDTFGHVGGTILGGLVGQKKPNNHGVPYSLTEEFTTVYRMHELLPDHLLLRDISA-- 406
225452532 325 LLKTDTLHAAMRGNWSGLLGKKFKDTYGHVGGAILGGLVGLKRPNNHGMPHSLTEEFVSVYRMHQLLPDHLLLRDISA-- 402
224099169 329 LLKTDTLLAGMRGNWYGLLGKNFKDKFGHVGGAILGGVVGLKKPENHGVPYSLTEEFVSVYRMHSLLPDHLQLRDISA-- 406
224121214 313 LLRTDTLLAGMRINWYGFLGKKIKDLFGHFGGPVLSGLVGLRRPRDHGVPYSLTEEFVSVYRMHSLLPEKLILRDIHS-- 390
255577350 319 LLKTNTLLAGMRINWYGFFGKKVKDLFGHFAGPLFSGLVGLRKPRDHGVPYSLTEEFTSVYRMHSLLPDQLIIRDIRS-- 396
297842117 318 LLKTDTLTAGMRINWYGFLGKKVKDMVGARFGPIFSGLVGLKKPKDHGVPYSLTEEFVSVYRMHCLLPETLILRDMKS-- 395
15232116  404 VPGTNKSLPLIQEISMRDLIGRKGEETMSHIGFTKLMVSMGHQASGALELMNYPMWLRDIVPHDPNGQARPDHVDLAALE 483
15219521  396 ENVDKENPAIEREIPMTELIGKKAGEKASKLGFEQLLVSMGHQSCGALTLWNYPNWMRNLVAQDIDGEDRPHLIDMAALE 475
115488462 397 QPDANNSPPCLEDIDIGEMIGLKGEEQLSKIGFEKQALSMGYQACGALELWNYPSFFRNLIPQNLDGTNRSDRIDLAALE 476
225456100 399 TASEGECPPLIEEVPMREMVGLEGEKRLSKIGMEKMMVSMGHQASGAMALWNYPSWMRNLVAHDVNGEDRPDLVDMAALE 478
225452530 407 APGLNKSPPLVKKLSMPNLIGHEGERALSEIGFARQMVSMGHQASGALQLWNYPVWLRDLIPQDVDGKDRSDHVDLPALE 486
225452532 403 SPGPNKSPPLIKKVPMQNLIGHQGEKALSEIGFTEQMVSMGHQACGALELWNYPVWLRDLIPQDVDGRNRPDPVDLPSLE 482
224099169 407 APDSHKSPPSTDKIPMPSLIGLVGEKTLSGIGFIKLMVSMGHQASGALEPWNYPMWLRDVVAQEVDGTDRPDHVDLAALE 486
224121214 391 TASEYECPPVVEEVPMREMAGKDGERRLSELGMEQMLVSMGHQACGAVKLWNYPSWMRNLVAHDINGEDRPDQVDMAAME 470
255577350 397 TTSESGCPPVLEEVPMKEMAGKEGEKKMSEIGMELMLVSMGHQACGAVTLWNYPSWMRNLVAHDINGEDRPDPVDMAAIE 476
297842117 396 ENVDKANPAIEREIPMTELIGKEAGLKGSKIGFEQLLVSMGHQSCGALTLWNYPNWMRNLVAQDIDGEDRPHLIDMAALE 475
15232116  484 IYRDRERSVPRYNEFRRSMFMIPITKWEDLTEDEEAIEVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFLIMA 563
15219521  476 IYRDRERGVPRYNEFRKNLLMSPISKWEELTDDEEAIKVLREVYEDDIEKLDLNVGLHAEKKIKGFAISETAFFIFLLVA 555
115488462 477 VYRDRERSVPRYNEFRRRLFLIPIKSWEDLTSDKDAIETIRAIYGDDVEKLDLLVGLMAEKKIKGFAISETAFNIFILMA 556
225456100 479 IYRDRERGVARYNEFRRNLLMIPISKWEDLTDDEKVVEALCEVYGDDVEKLDLLVGLHAEKKIKGFAICETAFFIFLLIA 558
225452530 487 IYRDRERKVARYNQFRRALLLIPISKWEDLTDDSETIKILRELYGDDVEELDTHVGLMAEKKIKGFAISETAFVIFIVMA 566
225452532 483 IYRDRERKVASYNQFRRALLLIPISKWEDLTDDTETIRSLRELYGDNVEELDTQVGLMAEKKIKGFAISETAFVIFIINA 562
224099169 487 VYRDRERNVARYNEFRRALLLIPISKWEDVTDDQEVIEALHQVYGDEVEELDLLVGLMAEKKIKGFAISETAFIIFLIMA 566
224121214 471 -SKDRERGVARYNEFRRNLLMIPISNWEDLTDDEEVIEALRDVYGNDVEKLDLLIGLHAEKKIKGFAISETAFFIFLLIA 549
255577350 477 IYRDRERGVARYNEFRRNLLMIPIRKWEDLTDEQEVVEALHEVYGDDVEKLDLLIGLHAEKKMKGFAISETAFFIFLLIA 556
297842117 476 IYRDRERGVPRYNEFRKNLLMSPISKWEELTDDEEAIKVLREVYEDDIEKLDLNVGLHAEKKIKGFAISETAFFIFLLVA 555
15232116  564 TRRLEADRFFTSDFNETIYTKKGLEWVNTTESLKDVIDRHYPDMTDKWMNSESAFSVWDSPPLTKNPIPLYLRIPS 639
15219521  556 SRRLEADRFFTTNFNEKTYTKEGLEWVNTTETLKDVIDRHFPRLTDQWMRCSSAFSVWGSDPNPKNWVPLYLRSAP 631
115488462 557 SRRLEADRFFTSNFNEETYTKKGMQWVKTTEGLRDVINRHYPEITAKWMKSSSAFSVWDADY-------------- 618
225456100 559 SRRLEADRFFTTNFNSQTYTRSGLDWVNKTETLQDVLDRHFPDMTKKWMRCSSAFSVWDSTPTPTNYIPLYLRPAP 634
225452530 567 SRRLGADRFFTSNFNEETYTKKGLEWVNTTESLKDVLDRHYPEMTEKWMNSSSAFSVWDSAPNAHNLVPLYLRVPH 642
225452532 563 SRRLEADRFFTSNFNEETYTKKGLEWVNTTESLKDVIHRHYPEMTDKWMNSSSAFSVWDSPPNPHNLVPLYLRVPH 638
224099169 567 TRRLEADRFFTSNFNEETYTKKGFEWVNSTESLKDVLDRHYPEMTAKWMNSASAFSVWDSPPPSPNPIPLLFRVPK 642
224121214 550 SRRLEADRFFTTNFNSRTYTEKGLEWVNKTETLKDVIDRHFPGMTKKWMKCTSAFSVWDSEPNQTTYIPLYLRPAP 625
255577350 557 SRRLEADRFFTTNFNSKSYTEKGLEWVNKTETLKDVIDRHFPGMTKKWMRCSSAFSVWDSEPDQMSYVPLYLRPAA 632
297842117 556 SRRLEADRFFTTNFNEKTYTKEGLEWVNTTETLKDVIDRHFPSLTDQWMRCSSAFSVWGSDPNPNTWVPLYLRSAP 631
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap