Conserved Protein Domain Family
PLN02282

?
PLN02282: PLN02282 
phosphoglycerate kinase
Statistics
?
PSSM-Id: 165923
View PSSM: PLN02282
Aligned: 9 rows
Threshold Bit Score: 755.653
Threshold Setting Gi: 115444481
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115444481   1 MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILASHLGRPKGVTPKYSLKPL 80 
30699430    1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCSHLGRPKGVTPKYSLKPL 80 
15219412    1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCSHLGRPKGVTPKYSLKPL 80 
115469436   1 MASKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVILASHLGRPKGVTPKYSLKPL 80 
224101333   1 MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVILSSHLGRPKGVTPKYSLKPL 80 
224109062   1 MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCSHLGRPKGVTPKYSLKPL 80 
225464999   1 MATKRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHGAKVILASHLGRPKGVTPKYSLKPL 80 
255544582   1 MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHGARVILCTHLGRPKGVTPKYSLKPL 80 
297842743   1 MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCSHLGRPKGVTPKYSLKPL 80 
115444481  81 VPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHAST 160
30699430   81 VPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST 160
15219412   81 VPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST 160
115469436  81 VPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLENVRFYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHAST 160
224101333  81 VPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLENVRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHAST 160
224109062  81 VPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVLLLENVRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHAST 160
225464999  81 VPRLSELLGVEVKMANDCIGEEVKILVAKIPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST 160
255544582  81 VPRLSELLGVEVKMASDCIGEEVEKLVAEIPEGGVLLLENVRFHKEEEKNEPEFAKKLAGLADVYVNDAFGTAHRAHAST 160
297842743  81 VPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST 160
115444481 161 EGVTKFLKPAVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDVLILGGGMIFTFYKAQGYAVGK 240
30699430  161 EGVAKFLKPSVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVGS 240
15219412  161 EGVAKFLKPSVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLNTVDILLLGGGMIFTFYKAQGLSVGS 240
115469436 161 EGVTKYLRPSVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLAKVDILILGGGMIYTFYKAQGYAVGK 240
224101333 161 EGVAKYLKPAVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDLLFLGGGMIYTFYKAQGHSVGS 240
224109062 161 EGVAKYLKPAVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSSKIGVIESLLEKVDFLFLGGGMIFTFYKAQGYSVGS 240
225464999 161 EGVAKYLKPSVAGFLMQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLGKVDVLLLGGGMIFTFYKAQGYGVGS 240
255544582 161 EGVAKYLKPSVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLEKVDILILGGGMIFTFYKAQGHSVGS 240
297842743 161 EGVAKYLKPSVAGFLMQKELDYLVGAVANPKKPFAAIVGGSKVSTKIGVIESLLSTVDILLLGGGMIFTFYKAQGLSVGS 240
115444481 241 SLVEEDKLELATSLIEKAKAKGVSLLLPTDVVVADKFAADAESKTVAASAIPDGWMGLDVGPDAIKTSSEALDTCNTIIW 320
30699430  241 SLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIW 320
15219412  241 SLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIW 320
115469436 241 SLVEEDKLELATSLIEKAKSKGVSLLLPTDIVVADKFAADAESKTVPASAIPDGWMGLDIGPDSIKTFSETLDTTKTVIW 320
224101333 241 SLVEEDKLDLATSLIEKAKVKGVKLLLPADVLVADKFAPDANSKVVPASEIPDGWMGLDIGPDSITTFSEALDTTKTIIW 320
224109062 241 SLVEEDKLDLATSLIEKAKVKGVKLLLPTDVVVADKFAPDANSKVVPASEIADGWMGLDIGPDSIKTFSEALDTTKTIIW 320
225464999 241 SLVEEDKLDLATSLLEKAKSKGVSLLLPADVVIADKFAADANSKVVPASCIPDGWMGLDIGPDSIKTFGESLDTTKTIIW 320
255544582 241 SLVEGDKLDLASSLIEKAKAKGVDLLLPTDVVIADKFAADANSKVVPASSIPDGWMGLDVGPDAIKTFCEALDTTQTIIW 320
297842743 241 SLVEEDKLDLAKSLMEKAKAKGVSLLLPTDVVIADKFAPDANSKIVPATAIPDGWMGLDIGPDSIKTFSEALDTTKTIIW 320
115444481 321 NGPMGVFEFEKFAAGTDAIAKKLADLtTTKGATTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALD 400
30699430  321 NGPMGVFEFDKFAAGTEAVAKQLAEL-SGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALD 399
15219412  321 NGPMGVFEFDKFAAGTEAVAKQLAEL-SGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALD 399
115469436 321 NGPMGVFEFEKFAAGTDAIAKKLADI-TAKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKTLPGVLALN 399
224101333 321 NGPMGVFEFEKFAAGTEAIARKLAEL-SGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALD 399
224109062 321 NGPMGVFEFEKFAAGTEAIAWKLAEL-SGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALD 399
225464999 321 NGPMGVFEFDKFALGTEAIAKKLADL-SEKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKTLPGVLALD 399
255544582 321 NGPMGVFEFDKFAVGTEAIAKKLAEL-SGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALD 399
297842743 321 NGPMGVFEFEKFAAGTEAVAKQLAEL-SGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKPLPGVLALD 399
115444481 401 EA 402
30699430  400 EA 401
15219412  400 EA 401
115469436 400 DA 401
224101333 400 DA 401
224109062 400 DA 401
225464999 400 DA 401
255544582 400 DA 401
297842743 400 DA 401
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap