Conserved Protein Domain Family
PLN02281

?
PLN02281: PLN02281 
chlorophyllide a oxygenase
Statistics
?
PSSM-Id: 177920
View PSSM: PLN02281
Aligned: 3 rows
Threshold Bit Score: 1033.53
Threshold Setting Gi: 42571757
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15219408    1 MNAAVFSPSALSLPISFSKTRSSFLSRKKGVKGEFRVFAVFGDESGLVEKKSQWRPLFDVEDPRSKAPPYKGKFLDVNQA 80 
42571757    1 MNAAVFSPSALSLPISFSKTRSSFLSRKKGVKGEFRVFAVFGDESGLVEKKSQWRPLFDVEDPRSKAPPYKGKFLDVNQA 80 
297852214   1 MNAAVFSASALSLPISFSKTRSSYLSRKKGVKGEFRIFAVFGDESGLLEKKSQWRPLFDVEDPRSKAPPYKGKFLDVNQA 80 
15219408   81 IEVARFDIQYLDWRARQDLLTIMILHDKVVDVLNPLAREYKSIGTVKKELAGLQEELSKAHQQVHISEARVSTALDKLAH 160
42571757   81 IEVARFDIQYLDWRARQDLLTIMILHDKVVDVLNPLAREYKSIGTVKKELAGLQEELSKAHQQVHISEARVSTALDKLAH 160
297852214  81 IEVARFDIQYLDWRARQDLLTIMILHDKVVDVLNPLAREYKSIGTVKKELAGLQEELSKAHQQVHISEARVSTALDKLAH 160
15219408  161 MEELVNDRLLPGRVVTELDKPSSSTTASAVELDREKTNTGAKSLNVSGPVPPYSPHLKNFWYPVAFTADLKHDTMVPIEC 240
42571757  161 MEELVNDRLLPGRVVTELDKPSSSTTASAVELDREKTNTGAKSLNVSGPVPPYSPHLKNFWYPVAFTADLKHDTMVPIEC 240
297852214 161 MEELVNDRLLPGRVVAELDKPSTSATASAVELDREKTNTGAKSLNVSGPVPPYSPHLKNFWYPVAFTADLKHDTMVPIEC 240
15219408  241 FEQPWVIFRGEDGKPGCVRNTCAHRACPLDLGTVNEGRIQCPYHGWEYSTDGECKKMPSTKLLKVKIKSLPCLEQEGMIW 320
42571757  241 FEQPWVIFRGEDGKPGCVRNTCAHRACPLDLGTVNEGRIQCPYHGWEYSTDGECKKMPSTKLLKVKIKSLPCLEQEGMIW 320
297852214 241 FEQPWVIFRGEDGKPGCVRNTCAHRACPLDLGTVNEGRIQCPYHGWEYSTDGECKKMPSTKLLKVKIKSLPCLEQEGMIW 320
15219408  321 IWPGDEPPAPILPSLQPPSGFLIHAELVMDLPVEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPTSGLQGYWD 400
42571757  321 IWPGDEPPAPILPSLQPPSGFLIHAELVMDLPVEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPTSGLQGYWD 400
297852214 321 IWPGDEPPAPTLPCLQPPSGFLIHAELVMDLPVEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPSSGLQGYWD 400
15219408  401 PYPIDMEFKPPCIVLSTIGISKPGKLEGKSTQQCATHLHQLHVCLPSSKNKTRLLYRMSLDFAPILKNLPFMEHLWRHFA 480
42571757  401 PYPIDMEFKPPCIVLSTIGISKPGKLEGKSTQQCATHLHQLHVCLPSSKNKTRLLYRMSLDFAPILKNLPFMEHLWRHFA 480
297852214 401 PYPIDMEFKPPCIVLSTIGISKPGKLEGKSTKQCATHLHQLHVCLPSSKNKTRLLYRMSLDFAPILKNLPFMEHLWRHFA 480
15219408  481 EQVlnedlrlvlgqqerMLNGANIWNLPVAYDKLGVRYRLWRNAV 525
42571757  481 EQV--------------KVHHKWIDHLQPSSQSCFLSYRFYISRS 511
297852214 481 EQVlnedlrlvlgqqerMLNGANIWNLPVAYDKLGVRYRLWRNAV 525
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap